DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnaJ

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_414556.1 Gene:dnaJ / 944753 ECOCYCID:EG10240 Length:376 Species:Escherichia coli


Alignment Length:378 Identity:103/378 - (27%)
Similarity:170/378 - (44%) Gaps:48/378 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 MPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLK-HFQELSNAYNILTDETKRLE 159
            |.|..||::|||::.|..::||.|:..||.:||||....:::.: .|:|:..||.:|||..||..
E. coli     1 MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAA 65

  Fly   160 YDQLGGIKDERAFLEQ---AGNPLNVGLEEAKKFDSDKTTNDEINKLKSN-------------EF 208
            |||.|     .|..||   .|.....|.:.:..|      .|....:...             .:
E. coli    66 YDQYG-----HAAFEQGGMGGGGFGGGADFSDIF------GDVFGDIFGGGRGRQRAARGADLRY 119

  Fly   209 DLPLDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKEP--CRRCNGTGKVMTKTPTFSS 271
            ::.|...||..|..|.|.:..|.:|:.|.|..     ...|.:|  |..|:|:|:|..:...|:.
E. coli   120 NMELTLEEAVRGVTKEIRIPTLEECDVCHGSG-----AKPGTQPQTCPTCHGSGQVQMRQGFFAV 179

  Fly   272 VNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQ-------V 329
            ..||..|:|:....::.|..|...|.|..:..:.|.:|:|...||.:.:.......:       :
E. coli   180 QQTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDL 244

  Fly   330 TYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKG 394
            ..::.|.....|.|.||::..:..:|.:.|.|||..::..|...|:|:|...||:.....:.|||
E. coli   245 YVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKVPGETQTGKLFRMRGKG 309

  Fly   395 VRSREG--VGNHIVTLKVRIPRNLSVKQRQLVLALSQA-EDPVFE---PKTKS 441
            |:|..|  .|:.:..:.|..|..|:.:|:||:..|.:: ..|..|   |::||
E. coli   310 VKSVRGGAQGDLLCRVVVETPVGLNERQKQLLQELQESFGGPTGEHNSPRSKS 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 96/358 (27%)
DnaJ 101..161 CDD:278647 24/60 (40%)
DnaJ_zf 233..296 CDD:199908 17/64 (27%)
DnaJ_C 298..416 CDD:199909 31/126 (25%)
dnaJNP_414556.1 PRK10767 1..372 CDD:236757 103/378 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.