DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and CAJ1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_010967.3 Gene:CAJ1 / 856772 SGDID:S000000850 Length:391 Species:Saccharomyces cerevisiae


Alignment Length:378 Identity:77/378 - (20%)
Similarity:132/378 - (34%) Gaps:118/378 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKH---------FQELSNAYNILTDETK 156
            ||.:||:...||..:|:.|:...|...|||        ||         ||.:..||.:|:|...
Yeast     7 YYDILGIKPEATPTEIKKAYRRKAMETHPD--------KHPDDPDAQAKFQAVGEAYQVLSDPGL 63

  Fly   157 RLEYDQLG--------GIKDERAFL--------------------------EQAGNPLNVGLEEA 187
            |.:|||.|        |.:|...:.                          |..|.....|....
Yeast    64 RSKYDQFGKEDAVPQQGFEDASEYFTAIFGGDGFKDWIGEFSLFKELNEATEMFGKEDEEGTAAT 128

  Fly   188 KKFDSDKTTNDEINKLKSNEFD-LPLDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKE 251
            :...:|::|:..:.|..:|:.: |..|.|..    ::|.:|..:.|    |.:..:|...|   |
Yeast   129 ETEKADESTDGGMVKHDTNKAESLKKDKLSK----EQREKLMEMEK----KRREDMMKQVD---E 182

  Fly   252 PCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCE----------------------TCSN 294
            ...:.|  .|:........|.|.      :.||.:.|.|                      |.:|
Yeast   183 LAEKLN--EKISRYLIAVKSNNL------EEFTRKLDQEIEDLKLESFGLELLYLLARVYKTKAN 239

  Fly   295 RGFVVSNVDVMVS-VPSGSRDG-----DVVNIINPETK-QQVTYRLSVPSSD----YFRRVGNDI 348
             .|::|.....:| :.:|:||.     ...|:::...: |:...::|..::|    |.|......
Yeast   240 -NFIMSKKTYGISKIFTGTRDNARSVKSAYNLLSTGLEAQKAMEKMSEVNTDELDQYERAKFEST 303

  Fly   349 LTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKGVRSREGV 401
            :..|.|.:..|:  ..|::....:.|           ...:||.|.|.|:|.:
Yeast   304 MAGKALGVMWAM--SKFELERKLKDV-----------CNKILNDKKVPSKERI 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 77/378 (20%)
DnaJ 101..161 CDD:278647 21/68 (31%)
DnaJ_zf 233..296 CDD:199908 14/84 (17%)
DnaJ_C 298..416 CDD:199909 22/115 (19%)
CAJ1NP_010967.3 DnaJ 2..>98 CDD:223560 27/98 (28%)
DnaJ-X 176..376 CDD:405064 36/193 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.