DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and YDJ1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_014335.1 Gene:YDJ1 / 855661 SGDID:S000005008 Length:409 Species:Saccharomyces cerevisiae


Alignment Length:370 Identity:91/370 - (24%)
Similarity:147/370 - (39%) Gaps:77/370 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLG- 164
            :|.:|||...||..:|:.|:...|.:||||...||:..:.|:|.|.||.||:|..||..|||.| 
Yeast     7 FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGE 71

  Fly   165 -----------------GIKDE--RAFLEQAGNPLNVGLEEAKKFDSDKTTN-DEINKLKSNEFD 209
                             |..|:  ..|....|.....|.:..|....:.:.: :|:.|.::.:..
Yeast    72 DGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLA 136

  Fly   210 LPLDFL----EATVGCKKRIELRYLRKCETCKGKSQLMAHRDVG------KEPCRRCNGTGKVMT 264
            |....|    |...|.|..:     :||.:|.|:......|.:|      :..|..|:|||.:: 
Yeast   137 LNKQILCKECEGRGGKKGAV-----KKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDII- 195

  Fly   265 KTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQ-- 327
                 ...:.|..|.||:..|....              :.|.|..|.:||..: :...|..|  
Yeast   196 -----DPKDRCKSCNGKKVENERKI--------------LEVHVEPGMKDGQRI-VFKGEADQAP 240

  Fly   328 -----QVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSF---QIRGLYESVEL----RVEP 380
                 .|.:.:|......|:|.|:|::.:..:::..||.||.|   .:.|.:..|.:    .:.|
Yeast   241 DVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAP 305

  Fly   381 GTQSHTQVVLNGKG--VRSREGVGNHIVTLKVRIPRNLSVKQRQL 423
            |.:.    |:.|||  :....|.||.|:...::.|.|....:..|
Yeast   306 GMRK----VIEGKGMPIPKYGGYGNLIIKFTIKFPENHFTSEENL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 91/370 (25%)
DnaJ 101..161 CDD:278647 25/59 (42%)
DnaJ_zf 233..296 CDD:199908 15/68 (22%)
DnaJ_C 298..416 CDD:199909 31/133 (23%)
YDJ1NP_014335.1 DnaJ 2..368 CDD:223560 91/370 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.