DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and APJ1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_014322.1 Gene:APJ1 / 855647 SGDID:S000005021 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:484 Identity:108/484 - (22%)
Similarity:171/484 - (35%) Gaps:155/484 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPD-STHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            |..|.|...|:..:|:.|:...|.:|||| :.|:|:..:.|||:..||.||.|...|..|||.|.
Yeast     8 YDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRALYDQYGT 72

  Fly   166 -----IKDERA----------------------------------FLEQAGNPLNVGLEEAKKFD 191
                 |::::|                                  |...:..|.:.|.:.:..|.
Yeast    73 TDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNSSATPSSNGSKSSFNFS 137

  Fly   192 SDKTTNDEIN---------------KLKSNEFDLPLD------------FLEATVGCKKRIELRY 229
            .:.::....:               |..||:.|..||            ..|..:|...::.|..
Yeast   138 FNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKHNLKCTLKELYMGKTAKLGLNR 202

  Fly   230 LRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKT----PTFSS-VNTCTQCKGKR--FTNRN 287
            .|.|..|.|      |..:.|..|:.|.|.| :.|:|    |...| ..||..|.|..  ..|::
Yeast   203 TRICSVCDG------HGGLKKCTCKTCKGQG-IQTQTRRMGPLVQSWSQTCADCGGAGVFVKNKD 260

  Fly   288 DCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQVT------------------YRLS 334
            .|:.|...||:.....:.|:|..||....:: ::..|..:.::                  .||.
Yeast   261 ICQQCQGLGFIKERKILQVTVQPGSCHNQLI-VLTGEGDEVISTKGGGHEKVIPGDVVITILRLK 324

  Fly   335 VPSSDYFRRVGNDILTDKHLNIS--EAILGGSFQIRGLYES---VELRVEPGTQSHTQVVLNG-- 392
            .|:   |:.:....|..|...|.  .::.||...|.| :.|   ::|.:.||     :::..|  
Yeast   325 DPN---FQVINYSNLICKKCKIDFMTSLCGGVVYIEG-HPSGKLIKLDIIPG-----EILKPGCF 380

  Fly   393 ------------KGVRSREGVGNHIVTLKVRIPRNL---SVKQRQLVLA---------------- 426
                        .||||  |.|:..|...|..|..|   :.|:.|.:||                
Yeast   381 KTVEDMGMPKFINGVRS--GFGHLYVKFDVTYPERLEPENAKKIQNILANDKYIKAERSTMETAD 443

  Fly   427 ------LSQAEDPVFEPKTKSTEAGNLSH 449
                  |.::.|.|.|....|.||.||::
Yeast   444 SDCYCDLEKSYDSVEEHVLSSFEAPNLNN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 100/464 (22%)
DnaJ 101..161 CDD:278647 22/59 (37%)
DnaJ_zf 233..296 CDD:199908 20/69 (29%)
DnaJ_C 298..416 CDD:199909 30/154 (19%)
APJ1NP_014322.1 DnaJ 2..427 CDD:223560 97/437 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.