DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and SEC63

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_014897.1 Gene:SEC63 / 854428 SGDID:S000005780 Length:663 Species:Saccharomyces cerevisiae


Alignment Length:98 Identity:28/98 - (28%)
Similarity:51/98 - (52%) Gaps:17/98 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPDS-----THSEQKL--KHFQELSNAYNILTDETKRLE 159
            |::||::..|:.:.|:||:..|:.::|||.     |..|:.:  :.:.:::.||..||||..|..
Yeast   127 YEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDELVRQN 191

  Fly   160 YDQLG----------GIKDERAFLEQAGNPLNV 182
            |.:.|          ||...|..::.:.:||.|
Yeast   192 YLKYGHPDGPQSTSHGIALPRFLVDGSASPLLV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 28/98 (29%)
DnaJ 101..161 CDD:278647 20/65 (31%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
SEC63NP_014897.1 SEC63 1..658 CDD:227694 28/98 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.