DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and JJJ2

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_012373.2 Gene:JJJ2 / 853277 SGDID:S000003698 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:382 Identity:83/382 - (21%)
Similarity:147/382 - (38%) Gaps:104/382 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PQSRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDET 155
            ||   :.:..||.:||:..:||..::..::..||:..|||.|.|::..:.|:.:.:|::|||||.
Yeast     7 PQ---LDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILTDED 68

  Fly   156 KRLEYDQLGGIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVG 220
            ::|.||:...||....:             :.||       |..|.|.|:.|          :.|
Yeast    69 QKLRYDRDLKIKGLHTY-------------QPKK-------NCHIFKTKAKE----------SQG 103

  Fly   221 CKKRIELRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMT-----KTPTFSSVNTCTQCKG 280
            ....:            |:|:....::...|......|.||.||     |.|.|.|.|..:..:.
Yeast   104 ASPTL------------GQSEAYHRQNKPYEQQPYGFGVGKKMTSSSKSKVPIFKSFNLKSYQRN 156

  Fly   281 KRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGD-VVNIINPETKQQVTYRLSVPSSDYFRRV 344
            ..::::.:.:                   .||.|.| :.:..|..:|.::|....:.::..|:.:
Yeast   157 HYYSSKKERK-------------------HGSPDIDSLFHETNGASKVRMTDAGKMDTNSQFQEI 202

  Fly   345 ----GNDILTDKHLNISE---AILGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKGVRSREGVG 402
                |.:..|  |.:.||   :.||.:...   :|..|   |.|.|...|       .:.::...
Yeast   203 WEILGKNAYT--HKSYSEDPNSCLGSALSD---HEEEE---EAGKQQQQQ-------QQQQQQQQ 252

  Fly   403 NHIVTLKVRIP-----RNLSVKQRQLVLALSQAEDPV----FE-PKTKSTEAGNLSH 449
            ::.:|.|...|     .|...|:...|......|:..    |: |||.:..:|  ||
Yeast   253 HYGMTSKSSSPDEEKKNNKEPKRESRVSPEENGEEETGHKQFKLPKTSTFSSG--SH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 73/347 (21%)
DnaJ 101..161 CDD:278647 21/59 (36%)
DnaJ_zf 233..296 CDD:199908 13/67 (19%)
DnaJ_C 298..416 CDD:199909 24/130 (18%)
JJJ2NP_012373.2 DnaJ 13..74 CDD:395170 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.