DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and ZUO1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_011801.1 Gene:ZUO1 / 853202 SGDID:S000003517 Length:433 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:42/186 - (22%)
Similarity:68/186 - (36%) Gaps:35/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNR---HATIQQIRSAFYALAKRYHPDSTH----SEQKLKHFQELSNAYNILTDETKRLE 159
            |..:|:::   .||..||..|......:||||...    |..:...|:.:..|:..|||..||.:
Yeast    99 YAAMGLSKLRFRATESQIIKAHRKQVVKYHPDKQSAAGGSLDQDGFFKIIQKAFETLTDSNKRAQ 163

  Fly   160 YDQLGGIKD--------ERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDL------ 210
            ||....:.|        :..|.|..|.........:||.......|.:.:|.:..:|..      
Yeast   164 YDSCDFVADVPPPKKGTDYDFYEAWGPVFEAEARFSKKTPIPSLGNKDSSKKEVEQFYAFWHRFD 228

  Fly   211 ---PLDFLEATV--GCKKRIELRYL-RKCETCKGKSQL--------MAHRDVGKEP 252
               ..:||:..|  ....|...||: ||.:..:.|.:.        :..|.|.::|
Yeast   229 SWRTFEFLDEDVPDDSSNRDHKRYIERKNKAARDKKKTADNARLVKLVERAVSEDP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 42/186 (23%)
DnaJ 101..161 CDD:278647 19/65 (29%)
DnaJ_zf 233..296 CDD:199908 4/28 (14%)
DnaJ_C 298..416 CDD:199909
ZUO1NP_011801.1 ZUO1 50..433 CDD:227594 42/186 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.