DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT1G76700

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_177796.1 Gene:AT1G76700 / 844003 AraportID:AT1G76700 Length:398 Species:Arabidopsis thaliana


Alignment Length:328 Identity:77/328 - (23%)
Similarity:130/328 - (39%) Gaps:106/328 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKH-FQELSNAYNILTDETKRLEYDQLG 164
            ||.||||:..||..:|:.|:|..|::.|||...::.:..| ||.|..||.:|:|..:|..||..|
plant     7 YYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSDSGQRQAYDACG 71

  Fly   165 --GIKDERAFLEQA-------GNPLNVG----LEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLE 216
              ||..: |.::.|       |:.|..|    |..|.....|..|       :.::||       
plant    72 KSGISTD-AIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFT-------EGDQFD------- 121

  Fly   217 ATVGCKKRIE--LRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCK 279
                 .|:|:  ||.::| |.....:|::..|                         :|      
plant   122 -----TKKIQEKLRIVQK-EREDKLAQILKDR-------------------------LN------ 149

  Fly   280 GKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDG-DVVNIIN--------PETKQQVTYRLSV 335
                      |...|:...:||.:..|:..|.:..| |::|.|.        .|..::..| |.|
plant   150 ----------EYVINKDEFISNAEAEVARLSNAAYGVDMLNTIGYIYVRQAAKELGKKAIY-LGV 203

  Fly   336 P-SSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESV-----------ELRVEPGTQSHTQV 388
            | .:::||..|:.|.:    .::.|.  |::.:..|.|.:           |..:|...|:|.:|
plant   204 PFIAEWFRNKGHFIKS----QLTAAT--GAYALFQLQEEMKRQLNTEGNYTEEELEEYLQAHKRV 262

  Fly   389 VLN 391
            :::
plant   263 MID 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 77/328 (23%)
DnaJ 101..161 CDD:278647 24/60 (40%)
DnaJ_zf 233..296 CDD:199908 6/62 (10%)
DnaJ_C 298..416 CDD:199909 26/115 (23%)
AT1G76700NP_177796.1 DnaJ 6..68 CDD:395170 24/60 (40%)
DnaJ-X 133..315 CDD:405064 33/182 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.