DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and ARG1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_177004.1 Gene:ARG1 / 843166 AraportID:AT1G68370 Length:410 Species:Arabidopsis thaliana


Alignment Length:377 Identity:78/377 - (20%)
Similarity:133/377 - (35%) Gaps:108/377 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AKRTSAGATPQQVSSPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPD-STHS 134
            ||:....:.|.....|               |:||.|::.|..|:|:||:..||.:|||| :.::
plant     3 AKKLEGSSAPANRRDP---------------YEVLCVSKDANDQEIKSAYRKLALKYHPDKNANN 52

  Fly   135 EQKLKHFQELSNAYNILTDETKRLEYDQLG-------GIKDE-------------RAFLEQAGNP 179
            ....:.|:|::.:|:||:|..||..||..|       |:..|             .|...:.|.|
plant    53 PDASELFKEVAFSYSILSDPEKRRHYDNAGFEALDADGMDMEIDLSNLGTVNTMFAALFSKLGVP 117

  Fly   180 L------NVGLEEA-------KKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELRYLR 231
            :      || ||||       :......:.:.::.|..::.|.:.:...:|..|...|:      
plant   118 IKTTVSANV-LEEAMNGTVTVRPLPIGTSVSGKVEKQCAHFFGVTISEQQAESGVVVRV------ 175

  Fly   232 KCETCKGKSQLM-----AHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCET 291
             ..|.:.|.:|:     :....|.........||||.:              .|..|.:      
plant   176 -TSTAQSKFKLLYFEQDSSGGYGLALQEEREKTGKVTS--------------AGMYFLH------ 219

  Fly   292 CSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQV--------TYRLSVPSSDYFRRVGNDI 348
                 |.|..:|..|:..:.::|.:.......|..|..        |:..:|...::|:.....|
plant   220 -----FQVYRMDTTVNALAAAKDPESAFFKRLEGLQPCEVSELKAGTHIFAVYGDNFFKTASYTI 279

  Fly   349 ----------LTDKHLNISEAILGGSFQIRGL---YESVELRVEPGTQSHTQ 387
                      .|:|...|...||....::|..   |.....|.:..|..:||
plant   280 EALCAKTYEDTTEKLKEIEAQILRKRNELRQFETEYRKALARFQEVTNRYTQ 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 74/347 (21%)
DnaJ 101..161 CDD:278647 23/60 (38%)
DnaJ_zf 233..296 CDD:199908 10/67 (15%)
DnaJ_C 298..416 CDD:199909 21/111 (19%)
ARG1NP_177004.1 DnaJ 16..>91 CDD:223560 27/89 (30%)
DnaJ 17..79 CDD:278647 24/76 (32%)
GrpE 288..>334 CDD:295646 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.