DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and DNAJC30

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_115693.2 Gene:DNAJC30 / 84277 HGNCID:16410 Length:226 Species:Homo sapiens


Alignment Length:101 Identity:31/101 - (30%)
Similarity:47/101 - (46%) Gaps:24/101 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QSRGMPKD----------------------YYYKVLGVNRHATIQQIRSAFYALAKRYHPD-STH 133
            |:||.|::                      ..|.:|||...||..||::|:|.....|||| ::.
Human    19 QARGFPQNSAPSLGLGARTYSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSG 83

  Fly   134 SEQKLKHFQELSNAYNILTDETKRLEYDQLGGIKDE 169
            |.:..:.|..:|.||.:|...|.|.:||: |.:.||
Human    84 SAEAAERFTRISQAYVVLGSATLRRKYDR-GLLSDE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 27/70 (39%)
DnaJ 101..161 CDD:278647 22/60 (37%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
DNAJC30NP_115693.2 DnaJ 50..111 CDD:278647 22/60 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..157 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.