DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT1G59725

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_176181.1 Gene:AT1G59725 / 842265 AraportID:AT1G59725 Length:331 Species:Arabidopsis thaliana


Alignment Length:368 Identity:85/368 - (23%)
Similarity:143/368 - (38%) Gaps:98/368 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPD----STHSEQKLKHFQELSNAYNILTDETKRLEYD 161
            ||.||.||..||...::.::..||.::|||    |...|.:.| |:::|.||::|:|..||..||
plant     5 YYNVLNVNPSATEDDLKKSYRRLAMKWHPDKNPTSIKQEAEAK-FKQISEAYDVLSDPNKRQIYD 68

  Fly   162 QLGGIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIE 226
            |.|  :|              ||...:...|.:..|  .:...:|.::....:            
plant    69 QYG--ED--------------GLTATEATASSQQHN--YSSGNNNNYNAGFRY------------ 103

  Fly   227 LRYLRKCETC----KGKSQLMAHRDVG-------KEPCRRCNGTGKVMTKTPTFSSVNTCT---Q 277
              |.|..|..    .|.|:.:....||       .|...:.|....|..|.|...|...||   .
plant   104 --YPRDAEDIFAEFFGASEKVFDGGVGGGGRFKSAEAGSQTNRKTPVNRKAPAIESKLACTLEEL 166

  Fly   278 CKGKRFTNRNDCETCSNRGFVVSNV------------DVM-VSVPSGSRDGDVVNIINPE----- 324
            .||.|            |...:|.|            ::: :.:..|.:.|  ..|..||     
plant   167 YKGGR------------RKMKISRVVPDGLGKSKPVEEILKIDITPGWKKG--TKITFPEKGNQE 217

  Fly   325 ---TKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQI-----RGLYESVELRVEPG 381
               |...:.:.:.......::|.|||::.||.:::.||:.|.:..:     |.|...|...|:||
plant   218 PGVTPADLIFVIDEKPHSVYKRDGNDLIVDKKVSLLEALTGITLSLTTLDGRNLTIPVLDIVKPG 282

  Fly   382 TQSHTQVVLNGKGVR-SREGV--GNHIVTLKVRIPRNLSVKQR 421
                .::|:..:|:. |:||.  |:..:..::..|..|:.:|:
plant   283 ----QEIVIPSEGMPISKEGSKRGDLRINFEICFPSRLTSEQK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 85/368 (23%)
DnaJ 101..161 CDD:278647 24/63 (38%)
DnaJ_zf 233..296 CDD:199908 16/76 (21%)
DnaJ_C 298..416 CDD:199909 30/146 (21%)
AT1G59725NP_176181.1 DnaJ 1..325 CDD:223560 85/368 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.