DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and GFA2

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_568690.1 Gene:GFA2 / 834854 AraportID:AT5G48030 Length:456 Species:Arabidopsis thaliana


Alignment Length:369 Identity:119/369 - (32%)
Similarity:180/369 - (48%) Gaps:38/369 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLK-HFQELSNAYNILTDETKRLEYD 161
            || ||.||||:::|...:|:.|:|.|||:.|||....:.:.: .|||:|.||.||.|:.||..||
plant    93 KD-YYSVLGVSKNAQEGEIKKAYYGLAKKLHPDMNKDDPEAETKFQEVSKAYEILKDKEKRDLYD 156

  Fly   162 QL----------GGIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFD------- 209
            |:          ||..:::.|....|...|       .||...:.|.:|..:...:..       
plant   157 QVGHEAFEQNASGGFPNDQGFGGGGGGGFN-------PFDIFGSFNGDIFNMYRQDIGGQDVKVL 214

  Fly   210 LPLDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNT 274
            |.|.|:||..||.|.:..:....|.||.|:.   ......:|.|:.|||:|....:....|...|
plant   215 LDLSFMEAVQGCSKTVTFQTEMACNTCGGQG---VPPGTKREKCKACNGSGMTSLRRGMLSIQTT 276

  Fly   275 CTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNI-----INPETKQ--QVTYR 332
            |.:|.|...|..:.|::|.....|.....|.|::..|..:.|.:.:     .:||..|  .:...
plant   277 CQKCGGAGQTFSSICKSCRGARVVRGQKSVKVTIDPGVDNSDTLKVARVGGADPEGDQPGDLYVT 341

  Fly   333 LSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKGVRS 397
            |.|.....|||.|:||..|..|::::|||||:.|:..|...|.::|.||||...:|||..||:|:
plant   342 LKVREDPVFRREGSDIHVDAVLSVTQAILGGTIQVPTLTGDVVVKVRPGTQPGHKVVLRNKGIRA 406

  Fly   398 REGV--GNHIVTLKVRIPRNLSVKQRQLVLALSQAEDPVFEPKT 439
            |:..  |:..|...|.||.|::.:||:|:...|:||...:|.:|
plant   407 RKSTKFGDQYVHFNVSIPANITQRQRELLEEFSKAEQGEYEQRT 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 113/356 (32%)
DnaJ 101..161 CDD:278647 27/60 (45%)
DnaJ_zf 233..296 CDD:199908 18/62 (29%)
DnaJ_C 298..416 CDD:199909 43/126 (34%)
GFA2NP_568690.1 DnaJ 90..450 CDD:223560 118/367 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53632
OrthoDB 1 1.010 - - D894595at2759
OrthoFinder 1 1.000 - - FOG0001676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.