DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT5G27240

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001318662.1 Gene:AT5G27240 / 832782 AraportID:AT5G27240 Length:1104 Species:Arabidopsis thaliana


Alignment Length:213 Identity:52/213 - (24%)
Similarity:76/213 - (35%) Gaps:52/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            :|.:|.|...|....|:.....||...|||..........|:.:.:|...|.|:.||.:||    
plant    67 WYGILQVMHFADDATIKKQVRKLALLLHPDKNQFPGAEAAFKLVWDASRFLADKDKRSQYD---- 127

  Fly   166 IKDERAFLEQAGNPLNV--GLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELR 228
            |: .|.:|..|.|.||.  ||:.|       .||...:           .|......|..|  .:
plant   128 IR-RRIYLRLATNQLNANSGLQCA-------ATNSATD-----------TFWTCCEHCGYR--YK 171

  Fly   229 YLRK-------CETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKG------ 280
            ||||       |..|: :|.:.......:.|.:...|..:|..:.|..:|:||..:..|      
plant   172 YLRKYVNILLNCNICQ-RSYMAYDTGFNEAPSKSNTGQKEVQNQGPCNTSLNTNGESIGAQPGSV 235

  Fly   281 -----------KRFTNRN 287
                       |:|..||
plant   236 AAEVDKKGTFNKKFNKRN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 52/213 (24%)
DnaJ 101..161 CDD:278647 16/59 (27%)
DnaJ_zf 233..296 CDD:199908 15/72 (21%)
DnaJ_C 298..416 CDD:199909
AT5G27240NP_001318662.1 DnaJ 66..127 CDD:395170 16/59 (27%)
infB 238..>356 CDD:177089 4/16 (25%)
DUF3444 474..668 CDD:403213
DUF3444 883..1075 CDD:403213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.