Sequence 1: | NP_648186.3 | Gene: | CG7387 / 38915 | FlyBaseID: | FBgn0035852 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001318662.1 | Gene: | AT5G27240 / 832782 | AraportID: | AT5G27240 | Length: | 1104 | Species: | Arabidopsis thaliana |
Alignment Length: | 213 | Identity: | 52/213 - (24%) |
---|---|---|---|
Similarity: | 76/213 - (35%) | Gaps: | 52/213 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
Fly 166 IKDERAFLEQAGNPLNV--GLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELR 228
Fly 229 YLRK-------CETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKG------ 280
Fly 281 -----------KRFTNRN 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7387 | NP_648186.3 | DnaJ_bact | 101..431 | CDD:274090 | 52/213 (24%) |
DnaJ | 101..161 | CDD:278647 | 16/59 (27%) | ||
DnaJ_zf | 233..296 | CDD:199908 | 15/72 (21%) | ||
DnaJ_C | 298..416 | CDD:199909 | |||
AT5G27240 | NP_001318662.1 | DnaJ | 66..127 | CDD:395170 | 16/59 (27%) |
infB | 238..>356 | CDD:177089 | 4/16 (25%) | ||
DUF3444 | 474..668 | CDD:403213 | |||
DUF3444 | 883..1075 | CDD:403213 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |