DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT5G25530

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_197935.1 Gene:AT5G25530 / 832628 AraportID:AT5G25530 Length:347 Species:Arabidopsis thaliana


Alignment Length:389 Identity:82/389 - (21%)
Similarity:140/389 - (35%) Gaps:123/389 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPD---STHSEQKLKHFQELSNAY--------NILTDE 154
            ||.:|.|||:||...::.::..||.::|||   :|.:|.:.| |:::|.||        .:|:|.
plant     5 YYDILKVNRNATEDDLKKSYRKLAMKWHPDKNPNTKTEAEAK-FKQISEAYEAKYEVMFQVLSDP 68

  Fly   155 TKRLEYDQLG--GIKD---------------------ERAFLEQAG-NPLNVGLE----EAKKFD 191
            .||..|||.|  |:.|                     |..|.|..| :|...|..    .:.:|.
plant    69 QKRAVYDQYGEEGLSDMPPPGSTGNNGRAGGFNPRNAEDIFAEFFGSSPFGFGSAGGPGRSMRFQ 133

  Fly   192 SD-----------KTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELRYLRKCETCKGKSQLMAH 245
            ||           .....|.|..::        :.|.|...||...:.                 
plant   134 SDGGGGMFGGFGGGNNGSENNIFRT--------YSEGTPAPKKPPPVE----------------- 173

  Fly   246 RDVGKEPC---RRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVM-V 306
               .|.||   ...:|:.:.|..:.:....|                      |......::: :
plant   174 ---SKLPCSLEELYSGSTRKMKISRSIVDAN----------------------GRQAQETEILTI 213

  Fly   307 SVPSGSRDGDVVNIINPETKQ------QVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSF 365
            .|..|.:.|..:...:...:|      .:.:.:.....|.|.|.|||::|.:.:.::|||.|.:.
plant   214 VVKPGWKKGTKIKFPDKGNEQVNQLPADLVFVIDEKPHDLFTRDGNDLITSRRVTLAEAIGGTTV 278

  Fly   366 QI-----RGLYESVELRVEPGTQSHTQVVLNGKGV---RSREGVGNHIVTLKVRIPRNLSVKQR 421
            .|     |.|...|...|.||    .:.|:.|:|:   :.....|:..:...|:.|..|:.:|:
plant   279 NINTLDGRNLPVGVAEIVSPG----YEFVVPGEGMPIAKEPRNKGDLKIKFDVQFPARLTTEQK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 82/389 (21%)
DnaJ 101..161 CDD:278647 24/70 (34%)
DnaJ_zf 233..296 CDD:199908 6/65 (9%)
DnaJ_C 298..416 CDD:199909 28/132 (21%)
AT5G25530NP_197935.1 DnaJ 1..342 CDD:223560 82/389 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.