DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and J2

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_568412.1 Gene:J2 / 832267 AraportID:AT5G22060 Length:419 Species:Arabidopsis thaliana


Alignment Length:399 Identity:89/399 - (22%)
Similarity:152/399 - (38%) Gaps:111/399 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKR 157
            ||......:|::|||.:.|..:.::.|:...|.:.|||.....:|   |:||:.||.:|:|..||
plant     7 SRKSDNTKFYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDPEK---FKELAQAYEVLSDPEKR 68

  Fly   158 LEYDQLG--GIKDE--------------RAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSN 206
            ..|||.|  .:|:.              .:|....|:|..    ...:....:...|.::.||.:
plant    69 EIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGSGGHPFG----SHSRGRRQRRGEDVVHPLKVS 129

  Fly   207 EFDLPLDFLEATVGCKKRIELR----------------YLRKCETCKGKSQLMAHRDVG------ 249
            ..|:.|       |..|::.|.                ...||..|:|....::.|..|      
plant   130 LEDVYL-------GTTKKLSLSRKALCSKCNGKGSKSGASMKCGGCQGSGMKISIRQFGPGMMQQ 187

  Fly   250 -KEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVM-VSVP--- 309
             :..|..|.|||:      |.:..:.|.||||::               |||...|: |:|.   
plant   188 VQHACNDCKGTGE------TINDRDRCPQCKGEK---------------VVSEKKVLEVNVEKGM 231

  Fly   310 --------SGSRD-------GDVVNIINPETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEA 359
                    ||..|       ||:|.:|..:...:            |:|.|.|:..:..::::||
plant   232 QHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPK------------FKRKGEDLFVEHTISLTEA 284

  Fly   360 ILGGSFQIRGL-YESVELRVEPG----TQSHTQVVLNGKGVRSREGV-GNHIVTLKVRIPRNLSV 418
            :.|..|.:..| ...:.::.:||    ..|:..:...|..:..|..: |...:...|..|.:||.
plant   285 LCGFQFVLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSP 349

  Fly   419 KQRQLVLAL 427
            .|.:.:.|:
plant   350 DQTKAIEAV 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 87/391 (22%)
DnaJ 101..161 CDD:278647 20/59 (34%)
DnaJ_zf 233..296 CDD:199908 16/69 (23%)
DnaJ_C 298..416 CDD:199909 30/142 (21%)
J2NP_568412.1 PTZ00037 7..419 CDD:240236 89/399 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.