DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT5G05750

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_196194.1 Gene:AT5G05750 / 830459 AraportID:AT5G05750 Length:294 Species:Arabidopsis thaliana


Alignment Length:336 Identity:68/336 - (20%)
Similarity:125/336 - (37%) Gaps:97/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ISGAATDCCRKTSHCLELDRAPAVAACWICMRMISQYQFRTTKPAYYPD-RQREAKRTSAGATPQ 81
            |.|..:|..:::......:.:|..||            ..::||:..|. |||.:..::||::..
plant    43 IDGLVSDLKKQSDEPAAEEDSPGSAA------------NESSKPSDRPSLRQRGSSSSAAGSSSS 95

  Fly    82 QVSSPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSN 146
            ..|:...:........|..||::||:..:.:::.:|.::..|:.:.|||...:....:.|:.:|.
plant    96 SSSTEEQRTIVREIKSKKDYYEILGLKSNCSVEDLRKSYRKLSLKVHPDKNKAPGSEEAFKSVSK 160

  Fly   147 AYNILTDETKRLEYDQLGGIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLP 211
            |:..|::|..|.:||  |...||.|:..:                .|...|:..|....:|||  
plant   161 AFQCLSNEDTRRKYD--GSGSDEPAYQPR----------------RDARRNNGFNGFYDDEFD-- 205

  Fly   212 LDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCT 276
                                                 ..|..|...|.|::...|..|.|.|.  
plant   206 -------------------------------------ADEIFRSFFGGGEMNPATTQFRSFNF-- 231

  Fly   277 QCKGKRFTNRNDCETCSNRGFVVSNVDVMVSV-PSGSRDGDVVNII------NPETKQQVTYRLS 334
             ..|.|..|:     .|:.||   |..|::.: |       ||.|:      :|:....:::|::
plant   232 -GGGTRTANQ-----ASDTGF---NPRVLLQILP-------VVFILLLNFLPSPQPIYSLSHRIT 280

  Fly   335 VPSSDYFRRVG 345
            ..|:.  .|:|
plant   281 TSSNS--PRIG 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 52/252 (21%)
DnaJ 101..161 CDD:278647 15/59 (25%)
DnaJ_zf 233..296 CDD:199908 12/62 (19%)
DnaJ_C 298..416 CDD:199909 11/55 (20%)
AT5G05750NP_196194.1 DnaJ 110..>217 CDD:223560 31/163 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.