DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT4G19590

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001328176.1 Gene:AT4G19590 / 827701 AraportID:AT4G19590 Length:374 Species:Arabidopsis thaliana


Alignment Length:389 Identity:88/389 - (22%)
Similarity:150/389 - (38%) Gaps:78/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LELDRAPAVAACWICMRMISQYQFRTTK------PAYYP--DRQREAKR-----TSAGATPQQVS 84
            :|.::..|:.|..|..|.:::..:...|      ...||  |..|:...     .|||.|   :|
plant     1 MECNKEEAIRAMDIAKRKVAENDYNGAKLFANKAQDLYPKLDGLRQVMMLIDVYISAGNT---IS 62

  Fly    85 SPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYN 149
                      |...| :|.:|||:..|..:.::..:..||...|||..:.|.....|:.:..|:.
plant    63 ----------GGESD-WYGILGVDPLADEEVVKKQYKRLALLLHPDKNNCEGAEGAFKLVLAAWC 116

  Fly   150 ILTDETKRLEYDQ---LGGIKDERAFLEQ------AGNPLNVGLEEAKKFDSDKTTNDE------ 199
            :|:|:.||:.|||   |..:|.:|:..::      ...|.....::.:..|..|...::      
plant   117 LLSDKVKRIAYDQKRKLNEVKPKRSRKQKQPPKKPPNQPKQQPNQQKQPPDQQKQPPNQPRQPPN 181

  Fly   200 INKLKSNEFDLPLDFLE------ATVG---CKK---RIELRYLRKCETCKGKSQLMAHRDVGKEP 252
            ..|...||...|.:..:      :|.|   .||   ::.: :...|..|:.:.:.:....:.|..
plant   182 QQKQPQNEPKQPPNQPKQPPNQASTNGRARSKKPTSKVSI-FWTMCNKCETQYEYVRVYYLNKTV 245

  Fly   253 -CRRCNGTGKV--MTKTPTFSSVNTCTQCKGKRFTNRN--------DCETCSNRGFVVS-NVDVM 305
             ||.|.|..|.  :.||||........:.:..:.||:|        |.::..|..|..| ..|..
plant   246 LCRNCRGNFKATEIEKTPTEKEKTPTEKEETPQATNKNTNGASSSCDRDSSLNVNFDSSFRRDSS 310

  Fly   306 VSVPSGSRDGDVVNIINPETKQQVTYRLS-------VPSSD--YFRRVGNDILTDKHLNISEAI 360
            :|..|....|:|.|......|::|  |.|       :.:||  ...||...:.||.:...|..|
plant   311 LSRMSYFNSGNVANQAEERGKREV--RESEEEAGRGIANSDLKVEERVFKKLRTDNYAESSSEI 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 71/308 (23%)
DnaJ 101..161 CDD:278647 17/59 (29%)
DnaJ_zf 233..296 CDD:199908 17/73 (23%)
DnaJ_C 298..416 CDD:199909 19/73 (26%)
AT4G19590NP_001328176.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.