DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT4G19580

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_193693.5 Gene:AT4G19580 / 827700 AraportID:AT4G19580 Length:312 Species:Arabidopsis thaliana


Alignment Length:285 Identity:55/285 - (19%)
Similarity:103/285 - (36%) Gaps:81/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VSSPAVKYPQSRGMPK-----DYY-------------YKVLGVNRHATIQQIRSAFYALAKRYHP 129
            :|.....||:..|:.:     |.|             |.:||::..|..:.::..:..||...||
plant    31 ISKAQALYPKLDGLEQVVMMIDVYISASNKINGEADWYGILGIDPLADEEAVKKQYKKLALLLHP 95

  Fly   130 DSTHSEQKLKHFQELSNAYNILTD------------ETKR----------LEYD---QLGGIKDE 169
            |..........|:.:.:|.::|:|            :|::          :.||   :...:|.:
plant    96 DKNRFNGAEGAFKLVRHARDLLSDQPCLIYNVQGQTQTQKSQNHTRTRTCVAYDHKRKPKQVKRK 160

  Fly   170 RAFLEQAGNP--------------LNVGLEEAKKFDSDKTTND-------EINKLKSNEFDLPLD 213
            |:..:....|              ::...|.|.:.:||.:.:|       :..|.:..|.|:.. 
plant   161 RSRTQDPPKPHKYKYKYEFRKRNRMHKPHEYAYECNSDSSESDPEPDSSWKQKKPRKQEEDITF- 224

  Fly   214 FLEATVGCKKRIELRYLRKCET-CK-GKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCT 276
               .|| ||.       .||.| || ||::::.....|: |....|...:..:|:.:.:|.::.|
plant   225 ---WTV-CKN-------NKCNTHCKLGKAEVIPEMKYGR-PVYSFNAKFQPTSKSTSDASSSSTT 277

  Fly   277 QCKGKRFTNRNDCETCSNRGFVVSN 301
            .....  .|.......|...||.:|
plant   278 STSDT--ANEAQDRESSQEEFVPAN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 50/262 (19%)
DnaJ 101..161 CDD:278647 15/94 (16%)
DnaJ_zf 233..296 CDD:199908 14/64 (22%)
DnaJ_C 298..416 CDD:199909 2/4 (50%)
AT4G19580NP_193693.5 DnaJ 66..119 CDD:278647 12/52 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.