DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and J3

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_189997.1 Gene:J3 / 823531 AraportID:AT3G44110 Length:420 Species:Arabidopsis thaliana


Alignment Length:388 Identity:87/388 - (22%)
Similarity:153/388 - (39%) Gaps:74/388 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            :|::|||.:.|:.:.::.|:...|.:.|||.....:|   |:||:.||.:|:|..||..|||.| 
plant    15 FYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEK---FKELAQAYEVLSDPEKREIYDQYG- 75

  Fly   166 IKDERAFLEQAG------NPLNVGLEEAKKFDS----------------DKTTNDEINKLKSNEF 208
               |.|..|..|      :|.::       |.|                .:...|.::.||.:..
plant    76 ---EDALKEGMGGGGGGHDPFDI-------FSSFFGGGPFGGNTSRQRRQRRGEDVVHPLKVSLE 130

  Fly   209 DLPLDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTG-KVMTKTPTFSSV 272
            |:.|       |..|::.|.....|..|.||..    :......|..|.|:| ||..:......:
plant   131 DVYL-------GTMKKLSLSRNALCSKCNGKGS----KSGASLKCGGCQGSGMKVSIRQLGPGMI 184

  Fly   273 ----NTCTQCK--GKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIIN-----PET- 325
                :.|.:||  |:...:|:.|..|.....:.....:.|:|..|.:....:....     |:| 
plant   185 QQMQHACNECKGTGETINDRDRCPQCKGDKVIPEKKVLEVNVEKGMQHSQKITFEGQADEAPDTV 249

  Fly   326 KQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGL-YESVELRVEPG----TQSH 385
            ...:.:.|.......|:|.|.|:..:..|:::||:.|..|.:..| ..|:.::..||    ..|:
plant   250 TGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGEVVKPDSY 314

  Fly   386 TQVVLNGKGVRSREGV-GNHIVTLKVRIPRNLSVKQRQLVLALSQAEDPVFEPKTKSTEAGNL 447
            ..:...|..:..|..: |...:...|..|.:||..|.:.:.|:.        ||..:.:..::
plant   315 KAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVL--------PKPSTAQLSDM 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 85/370 (23%)
DnaJ 101..161 CDD:278647 20/59 (34%)
DnaJ_zf 233..296 CDD:199908 17/69 (25%)
DnaJ_C 298..416 CDD:199909 25/129 (19%)
J3NP_189997.1 PTZ00037 7..420 CDD:240236 87/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.