DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT3G08910

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_187503.1 Gene:AT3G08910 / 820040 AraportID:AT3G08910 Length:323 Species:Arabidopsis thaliana


Alignment Length:365 Identity:78/365 - (21%)
Similarity:137/365 - (37%) Gaps:100/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQK--LKHFQELSNAYNILTDETKRLEYDQL 163
            |||||.|:|:|....::.|:..||.::|||...:.:|  ...|:::|.||::|:|..||..|||.
plant     5 YYKVLQVDRNAKDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKRAIYDQY 69

  Fly   164 ---------------GGIKDERA------------------FLEQAGNPLNVGLEEAKKFDSDKT 195
                           ||..|..|                  |....|:....|.....:|..|..
plant    70 GEEGLTSQAPPPGAGGGFSDGGASFRFNGRSADDIFSEFFGFTRPFGDSRGAGPSNGFRFAEDVF 134

  Fly   196 TNDEI--NKLKSNEFDLPLDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKEPCRRCNG 258
            :::.:  .|....|..||....:...|..|::::                 .|||       .:.
plant   135 SSNVVPPRKAAPIERQLPCSLEDLYKGVSKKMKI-----------------SRDV-------LDS 175

  Fly   259 TGKVMTKTPTFSSVNTCTQCKGKRFT---NRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNI 320
            :|:..|.....:........||.:.|   ..|:     .||.:.|               |:|.|
plant   176 SGRPTTVEEILTIEIKPGWKKGTKITFPEKGNE-----QRGIIPS---------------DLVFI 220

  Fly   321 INPETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGL-YESVELRVEPGTQS 384
            ::.:           |.: .|:|.|||::..:.:.:.||:.|.:.|:..| ..||.:.:......
plant   221 VDEK-----------PHA-VFKRDGNDLVMTQKIPLVEALTGYTAQVSTLDGRSVTVPINNVISP 273

  Fly   385 HTQVVLNGKGV---RSREGVGNHIVTLKVRIPRNLSVKQR 421
            ..:.|:.|:|:   :.....||..:...|:.|..|:.:|:
plant   274 SYEEVVKGEGMPIPKDPSKKGNLRIKFTVKFPSRLTTEQK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 78/365 (21%)
DnaJ 101..161 CDD:278647 23/61 (38%)
DnaJ_zf 233..296 CDD:199908 9/65 (14%)
DnaJ_C 298..416 CDD:199909 24/121 (20%)
AT3G08910NP_187503.1 DnaJ 1..313 CDD:223560 77/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.