DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AT3G04980

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001326461.1 Gene:AT3G04980 / 819658 AraportID:AT3G04980 Length:1183 Species:Arabidopsis thaliana


Alignment Length:324 Identity:58/324 - (17%)
Similarity:112/324 - (34%) Gaps:91/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LELDRAPAVAACWICMR------MISQYQFRTTKPAYYPDRQREAKRTSAGATPQQVSSPAVKYP 91
            :|.::..|:.|..|...      .:..::|.|.....:|:.:...:.    .|...|.|.|:|  
plant     1 MECNKEDAIRASKIAEEKMEAGDFVGAHKFVTKAQRLFPNLENIVQM----MTICDVHSSAIK-- 59

  Fly    92 QSRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETK 156
            :.:|:  |.:|.||.|..:|....|:..:..||...|||..........|:.:..|..:|:|:.|
plant    60 KIKGL--DDWYGVLQVQPYADADTIKKQYRKLALLLHPDKNKFAGAEAAFKLVGEANRLLSDQIK 122

  Fly   157 RLEYDQLGGIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGC 221
            |.:||                                       |:.:|:           ::..
plant   123 RSQYD---------------------------------------NRYRSH-----------SMFA 137

  Fly   222 KKRIELRYLRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNT---CTQCKGKRF 283
            .:.:.:...|.|......::.:|........||.|....|.:.:     .:||   |:.|:....
plant   138 NRHVNVYSGRHCAATNNAAENIAGVFTFWTRCRHCGQCYKYLRE-----YMNTSMHCSSCQKSFV 197

  Fly   284 TNRNDCE-------TCSNRGF---VVSNV---DVMVSVPSGS------RDGDVVNIINPETKQQ 328
            ..:..|:       |...:.|   |:||.   :...:..|||      ::|.|...:|.:.:::
plant   198 ACKMRCDGVPPSSSTAGRKEFQDQVMSNTSRQNASTAAESGSSAADMGKNGKVGGKVNKKNQEK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 44/250 (18%)
DnaJ 101..161 CDD:278647 17/59 (29%)
DnaJ_zf 233..296 CDD:199908 12/72 (17%)
DnaJ_C 298..416 CDD:199909 9/40 (23%)
AT3G04980NP_001326461.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.