Sequence 1: | NP_648186.3 | Gene: | CG7387 / 38915 | FlyBaseID: | FBgn0035852 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001324689.1 | Gene: | AT2G21510 / 816690 | AraportID: | AT2G21510 | Length: | 353 | Species: | Arabidopsis thaliana |
Alignment Length: | 200 | Identity: | 49/200 - (24%) |
---|---|---|---|
Similarity: | 87/200 - (43%) | Gaps: | 55/200 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSE-QKLKHFQELSNAYNILTDETKRLEYDQLG 164
Fly 165 --GIKDE---------------RAFLEQAGNPLNVGLEEAKKFDSDKTTND-EI------NKLKS 205
Fly 206 NEFDLPLDFLEATVGCKKRIELRYLRKCE-------------TCKGKSQLMAH-----------R 246
Fly 247 DVGKE 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7387 | NP_648186.3 | DnaJ_bact | 101..431 | CDD:274090 | 49/199 (25%) |
DnaJ | 101..161 | CDD:278647 | 23/60 (38%) | ||
DnaJ_zf | 233..296 | CDD:199908 | 5/42 (12%) | ||
DnaJ_C | 298..416 | CDD:199909 | |||
AT2G21510 | NP_001324689.1 | DnaJ | 2..>92 | CDD:223560 | 27/84 (32%) |
DnaJ-X | 135..325 | CDD:405064 | 12/68 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |