DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7387 and Dnajc21

DIOPT Version :9

Sequence 1:	NP_648186.3	Gene:	CG7387 / 38915	FlyBaseID:	FBgn0035852	Length:	449	Species:	Drosophila melanogaster
Sequence 2:	NP_084322.2	Gene:	Dnajc21 / 78244	MGIID:	1925371	Length:	531	Species:	Mus musculus

Alignment Length:	77	Identity:	24/77 - (31%)
Similarity:	44/77 - (57%)	Gaps:	8/77 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDST--HSEQKLKHFQELSNAYNILTDETKRLEYDQ- 162
            :|:.|||.|.|:.::::.|:..||.|:|||..  ::.:..:.|:.:..||::|:|..:|..||.
Mouse     4 HYEALGVRRDASEEELKKAYRKLALRWHPDKNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYDNH 68

  Fly   163 -----LGGIKDE 169
                 .||:..|
Mouse    69 REALLKGGLDGE 80

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7387	NP_648186.3	DnaJ_bact	101..431	CDD:274090	24/77 (31%)
		DnaJ	101..161	CDD:278647	19/61 (31%)
		DnaJ_zf	233..296	CDD:199908
		DnaJ_C	298..416	CDD:199909
Dnajc21	NP_084322.2	DnaJ	3..66	CDD:278647	19/61 (31%)
		DBINO	<181..243	CDD:290603
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	278..309
		zf-C2H2_jaz	314..339	CDD:288983
		C2H2 Zn finger	316..338	CDD:275371
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	327..480
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	507..531
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910