DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajb2

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_006245338.1 Gene:Dnajb2 / 689593 RGDID:1591035 Length:324 Species:Rattus norvegicus


Alignment Length:330 Identity:77/330 - (23%)
Similarity:124/330 - (37%) Gaps:81/330 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKL--KHFQELSNAYNILTDETKRLEYDQL 163
            ||::|.|.|.|:...|:.|:...|.::|||.....::.  |.|:|::.||.:|:|:.||..||:.
  Rat     4 YYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68

  Fly   164 GGIKDERAFLEQAGN-PLNV---GLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKR 224
            |     |..|..||: |...   |:|..  |.....:.:|:.:......| |...|...:|....
  Rat    69 G-----REGLTGAGSGPSRSETGGMEPG--FTFTFRSPEEVFREFFGSGD-PFSELFDDLGAFSE 125

  Fly   225 IELRYLRKCETCKG-----KSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQ-CKGKRF 283
            ::.:..|    ..|     .|....:.|..........|.|       .|.||:|.|. .:|:|.
  Rat   126 LQNQGSR----LTGPFFTFSSSFPGNSDFSSSSFSFSPGAG-------AFRSVSTSTTFVQGRRI 179

  Fly   284 TNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNI-IN--------------PETKQQVTYRL 333
            |.|...|....|      |:|       ..||.:.:: ||              .|.:..||..|
  Rat   180 TTRRIMENGQER------VEV-------EEDGQLKSVSINGVPDDLALGLELSRREQQPSVTPGL 231

  Fly   334 SV----PSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKG 394
            .|    |:| ..|...:|:..|:.:.::.|           |...|:      ::..|....|:|
  Rat   232 GVMQVRPTS-VSRPPDSDLSEDEDMQLAMA-----------YSLSEM------EASGQKPAGGRG 278

  Fly   395 VRSRE 399
            ...|:
  Rat   279 APQRQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 77/330 (23%)
DnaJ 101..161 CDD:278647 21/61 (34%)
DnaJ_zf 233..296 CDD:199908 15/68 (22%)
DnaJ_C 298..416 CDD:199909 23/121 (19%)
Dnajb2XP_006245338.1 DnaJ 3..>110 CDD:223560 33/112 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.