DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajc5b

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001157008.1 Gene:Dnajc5b / 66326 MGIID:1913576 Length:199 Species:Mus musculus


Alignment Length:242 Identity:52/242 - (21%)
Similarity:91/242 - (37%) Gaps:70/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSE-QKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            |::||:::.|:.::|:..:..||.|:|||....: ...:.|:|::||:.||||.:||..||:.| 
Mouse    21 YEILGLHKGASCEEIKKTYRKLALRHHPDKNPDDPSAAEKFKEINNAHTILTDTSKRNIYDKYG- 84

  Fly   166 IKDERAFLEQAGNPLNVGLEEAKKF-DSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELRY 229
                           ::||..|::| |.:..|...::...:....:.:..|   .||       |
Mouse    85 ---------------SLGLYVAEQFGDENVNTYFMLSSWWAKTLFIIIGLL---TGC-------Y 124

  Fly   230 LRKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSN 294
            ...|..|                |..|                 .|..|:.|..|...:      
Mouse   125 FCCCLCC----------------CCNC-----------------CCGHCRPKSSTPEEE------ 150

  Fly   295 RGFVVSNVDVMVSVPSG-SRDGDVVNIINPETKQQVTYRLSVPSSDY 340
              |.||..|:...:.:. .:|.|...::.|....:.|..:...|..|
Mouse   151 --FYVSPEDLEEQIRTDMEKDMDFPVVLQPTNTNEKTQLIREGSRSY 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 52/242 (21%)
DnaJ 101..161 CDD:278647 21/59 (36%)
DnaJ_zf 233..296 CDD:199908 8/62 (13%)
DnaJ_C 298..416 CDD:199909 9/44 (20%)
Dnajc5bNP_001157008.1 DnaJ 19..>88 CDD:223560 24/82 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.