DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajc30

DIOPT Version :10

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_079638.2 Gene:Dnajc30 / 66114 MGIID:1913364 Length:219 Species:Mus musculus


Alignment Length:101 Identity:31/101 - (30%)
Similarity:50/101 - (49%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SPAVKYPQSRGMP---------------KDYYYKVLGVNRHATIQQIRSAFYALAKRYHPD-STH 133
            ||..::.|.||:|               :...|::|||...||..||::|:|..:..|||| :..
Mouse    12 SPLWRWWQVRGLPPSSATGLCSRGRTYSRTALYELLGVPSTATQAQIKAAYYRQSFLYHPDRNPG 76

  Fly   134 SEQKLKHFQELSNAYNILTDETKRLEYDQLGGIKDE 169
            |.:..:.|..:|.||.:|.....|.:||: |.:.|:
Mouse    77 SAEAAERFTRVSEAYLVLGSTILRRKYDR-GLLSDQ 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 25/70 (36%)
Dnajc30NP_079638.2 DnaJ 44..>106 CDD:440252 23/62 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..148 1/3 (33%)

Return to query results.
Submit another query.