DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7387 and DNAJC1

DIOPT Version :9

Sequence 1:	NP_648186.3	Gene:	CG7387 / 38915	FlyBaseID:	FBgn0035852	Length:	449	Species:	Drosophila melanogaster
Sequence 2:	NP_071760.2	Gene:	DNAJC1 / 64215	HGNCID:	20090	Length:	554	Species:	Homo sapiens

Alignment Length:	136	Identity:	36/136 - (26%)
Similarity:	55/136 - (40%)	Gaps:	28/136 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQ--L 163
            :|:.|||.:.|:...||.|:..|:...|||....|.....|::|...|.:|.|:.:|..||.  :
Human    66 FYQFLGVQQDASSADIRKAYRKLSLTLHPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDILI 130

  Fly   164 GGIKDER--AFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIE 226
            .|:.|.|  .|..:                       .:.|:.:.|..|.| |:..|||....:.
Human   131 NGLPDWRQPVFYYR-----------------------RVRKMSNAELALLL-FIILTVGHYAVVW 171

  Fly   227 LRYLRK 232
            ..||.|
Human   172 SIYLEK 177

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7387	NP_648186.3	DnaJ_bact	101..431	CDD:274090	36/136 (26%)
		DnaJ	101..161	CDD:278647	19/59 (32%)
		DnaJ_zf	233..296	CDD:199908	36/136 (26%)
		DnaJ_C	298..416	CDD:199909
DNAJC1	NP_071760.2	DnaJ	65..126	CDD:278647	19/59 (32%)
		SANT	329..375	CDD:238096
		SANT	495..544	CDD:197842
		SANT	496..543	CDD:238096
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910