DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and zgc:122979

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001032663.2 Gene:zgc:122979 / 641576 ZFINID:ZDB-GENE-051127-45 Length:360 Species:Danio rerio


Alignment Length:388 Identity:83/388 - (21%)
Similarity:139/388 - (35%) Gaps:120/388 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QVSSPAVKYPQSRGMPKDY-YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELS 145
            :||||    |.|   |:.. ||.||||:..:..::||.|:..||.|||||..........|::::
Zfish    39 EVSSP----PPS---PECVDYYSVLGVSNDSNEEEIRKAYKRLALRYHPDKNSDADAEDKFKQIA 96

  Fly   146 NAYNILTDETKRLEYDQLGGIKDERAFLEQAGNPLNVGLEEAKK----FDSDKTTNDEI------ 200
            .||::|||..||..|||.|..|...|......:|.:....:|..    |:.|..::|::      
Zfish    97 QAYDVLTDPEKRNIYDQQGLTKGGVAPTCNKTDPSHNSKADAHSWHMFFNFDLDSDDDLFNPFTR 161

  Fly   201 -----------NK--LK----SNEFDLPLDFLEATVGCKKRIELRYLRKCE--TCKGKSQLMAHR 246
                       ||  ||    :...||.:...:..:|..||::|..||:.:  |.|.:.::..  
Zfish   162 NPLPHLSRHHGNKGGLKPAGDAEVHDLSVSLEDILMGVTKRVKLTRLRQTDKHTLKPEERVFD-- 224

  Fly   247 DVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSG 311
                                                                       |.|..|
Zfish   225 -----------------------------------------------------------VEVKKG 230

  Fly   312 SRDGDVVNIINP------ETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGL 370
            .::|..:...|.      .....:.:.:......:|||.|:.|:....:.:.||:.|.:..:   
Zfish   231 WKEGTRITFPNEGHQMLGHAPNDLAFVIKEKKHAHFRRDGSHIVYTCTITLREALCGCTVNV--- 292

  Fly   371 YESVELRVEPGTQSHTQVVLNGKGVRSREGVGNHIVTLKVRIPRNLSVKQRQLVLALSQAEDP 433
             .:::.:::|...|.   |:....||...|.|         :||..:..||..:|...|...|
Zfish   293 -PTLDGQMKPLPCSD---VIKPSSVRRLIGEG---------LPRAKNPAQRGDLLVEFQVVFP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 75/364 (21%)
DnaJ 101..161 CDD:278647 24/59 (41%)
DnaJ_zf 233..296 CDD:199908 2/64 (3%)
DnaJ_C 298..416 CDD:199909 22/123 (18%)
zgc:122979NP_001032663.2 DnaJ 50..355 CDD:223560 76/370 (21%)
DnaJ 51..112 CDD:278647 24/60 (40%)
DnaJ_C 185..345 CDD:199909 37/235 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.