DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7387 and Dnajb2

DIOPT Version :9

Sequence 1:	NP_648186.3	Gene:	CG7387 / 38915	FlyBaseID:	FBgn0035852	Length:	449	Species:	Drosophila melanogaster
Sequence 2:	XP_036008391.1	Gene:	Dnajb2 / 56812	MGIID:	1928739	Length:	365	Species:	Mus musculus

Alignment Length:	137	Identity:	28/137 - (20%)
Similarity:	51/137 - (37%)	Gaps:	23/137 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   269 FSSVNTCTQ-CKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQVTYR 332
            |.||:|.|. .:|:|.|.|...|....|..|..:..:.....:|..|...:.:.....:||.:..
Mouse   205 FRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVSINGVPDDLALGLELSRREQQPSVA 269

  Fly   333 -----LSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNG 392
                 :.|..:...|...:|:..|:.|.::.|           |...|:      ::..|....|
Mouse   270 PGLGVMQVRPTSLSRPPDHDLSEDEDLQLAMA-----------YSLSEM------EAAGQKPAGG 317

  Fly   393 KGVRSRE 399
            :|.:.|:
Mouse   318 RGAQQRQ 324

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7387	NP_648186.3	DnaJ_bact	101..431	CDD:274090	28/137 (20%)
		DnaJ	101..161	CDD:278647
		DnaJ_zf	233..296	CDD:199908	10/27 (37%)
		DnaJ_C	298..416	CDD:199909	17/107 (16%)
Dnajb2	XP_036008391.1	PRK14294	102..>151	CDD:237664
Dnajb2	XP_036008391.1	UIM	291..310	CDD:197845	5/35 (14%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910