powered by:
Protein Alignment CG7387 and Dnajb8
DIOPT Version :9
Sequence 1: | NP_648186.3 |
Gene: | CG7387 / 38915 |
FlyBaseID: | FBgn0035852 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_064348.1 |
Gene: | Dnajb8 / 56691 |
MGIID: | 1922801 |
Length: | 227 |
Species: | Mus musculus |
Alignment Length: | 66 |
Identity: | 28/66 - (42%) |
Similarity: | 42/66 - (63%) |
Gaps: | 2/66 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDST--HSEQKLKHFQELSNAYNILTDETKRLEYDQL 163
||:||||...|:.:.|:.|:..||.|:|||.. :.|:..|.|:::|.||.:|:|..||..||:.
Mouse 4 YYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDRA 68
Fly 164 G 164
|
Mouse 69 G 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.