DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AgaP_AGAP005908

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_001688751.1 Gene:AgaP_AGAP005908 / 5667045 VectorBaseID:AGAP005908 Length:403 Species:Anopheles gambiae


Alignment Length:389 Identity:117/389 - (30%)
Similarity:187/389 - (48%) Gaps:37/389 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YPDRQREAKRTSAGATPQQVSSPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYH 128
            :|...:.|.:..:..:..:.||.||..|:.. .||| :|.||||:|.|:...|:.|:|.|||::|
Mosquito    25 FPSGDKSADKQPSSKSTGKSSSKAVPPPKVT-PPKD-FYAVLGVSRTASFNDIKKAYYELAKQFH 87

  Fly   129 PDSTHSEQKL------------KHFQELSNAYNILTDETKR-------LEYDQLGGIKDERAFLE 174
            ||...::|..            |.|.:::.||..|..|.|.       |.......::.:...|.
Mosquito    88 PDRRTAQQNSNSTAKESTAAMEKKFSQITEAYEALLVEVKHRTESVVDLNPSLYRDLQKKHMLLP 152

  Fly   175 QAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELRYLRKCETCKGK 239
            :.|...|.         :..||  .||:|...:..|.|.|.|:..|..:.:.|....||:.|...
Mosquito   153 KNGQSGNT---------APPTT--LINELNYEDVVLTLTFKESIEGTVRELTLPIGVKCDRCSYT 206

  Fly   240 SQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFT-NRNDCETCSNRGFVVSNVD 303
            ....|....|.  |..|:||||....|.:...:..|..|.|.:.| ::..|..|..:|.|:....
Mosquito   207 GTQSALDPEGL--CSICHGTGKQEFHTESGKLLMPCKFCNGSKHTPHKLTCPKCHGKGIVMKQHP 269

  Fly   304 VMVSVPSGSRDGDVVNIINPETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIR 368
            :.||:|..|:..|.:.:..|..::|:|..|.|....:|||||.:|.:.:.:.:.:||.||...||
Mosquito   270 LTVSIPKASQHKDRLKVRIPGLQRQLTVILHVQDQGHFRRVGLNIYSTEEITMLKAIRGGDLSIR 334

  Fly   369 GLYESVELRVEPGTQSHTQVVLNGKGVRS--REGVGNHIVTLKVRIPRNLSVKQRQLVLALSQA 430
            |:.....:.:|||||..|::.:.|||:|.  |:.||:||:||::|:||.|:.:|.||:....:|
Mosquito   335 GINGIFNVYLEPGTQFGTELRIPGKGLRDELRQDVGDHILTLQIRLPRTLTPRQLQLLEEFERA 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 107/352 (30%)
DnaJ 101..161 CDD:278647 25/78 (32%)
DnaJ_zf 233..296 CDD:199908 17/63 (27%)
DnaJ_C 298..416 CDD:199909 44/119 (37%)
AgaP_AGAP005908XP_001688751.1 DnaJ 59..398 CDD:223560 107/352 (30%)
DnaJ 59..122 CDD:278647 22/63 (35%)
DnaJ_zf 200..262 CDD:304418 17/63 (27%)
DnaJ_C 263..384 CDD:199909 44/120 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53632
OrthoDB 1 1.010 - - D894595at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44145
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.