DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnaja2

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_062768.1 Gene:Dnaja2 / 56445 MGIID:1931882 Length:412 Species:Mus musculus


Alignment Length:400 Identity:89/400 - (22%)
Similarity:154/400 - (38%) Gaps:125/400 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPD-STHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            |.:|||...|:..:::.|:..|||.|||| :.::..|   |:|:|.||.:|::..||..||:.| 
Mouse    10 YDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDK---FKEISFAYEVLSNPEKRELYDRYG- 70

  Fly   166 IKDERAFLEQAG--------------------------------------NPLNVGLEEAKKFDS 192
               |:...|.:|                                      :||.|.||:   ..:
Mouse    71 ---EQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLED---LYN 129

  Fly   193 DKTTNDEINKLKSNEFDLPLDFLEATVGCK----KRIELRYLRKCETCKGKSQLMAHRDVG---- 249
            .|||..:::|               .|.|.    :..:...::||..|:|:...:..|.:.    
Mouse   130 GKTTKLQLSK---------------NVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMV 179

  Fly   250 ---KEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVM-VSVPS 310
               :..|..|||.|:|:.:.      :.|.:|:||:               |:..|.:: |.|..
Mouse   180 QQMQSVCSDCNGEGEVINEK------DRCKKCEGKK---------------VIKEVKILEVHVDK 223

  Fly   311 GSRDGDVVNIINPETKQ-------QVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIR 368
            |.:.|..:.... |..|       .:...|.....:.|:|.|||:.....:.:.||:.|..|..:
Mouse   224 GMKHGQRITFTG-EADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFK 287

  Fly   369 GL--------YESVELRVEPGTQSHTQVVLNGKGV---RSREGVGNHIVTLKVRIPRNLSVKQRQ 422
            .|        |...:: :|||...    |:.|:|:   |:....|:..:...|:.|.|..:...:
Mouse   288 HLDARQIVVKYPPGKV-IEPGCVR----VVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDK 347

  Fly   423 LVLALSQAED 432
                ||:.||
Mouse   348 ----LSELED 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 87/397 (22%)
DnaJ 101..161 CDD:278647 22/59 (37%)
DnaJ_zf 233..296 CDD:199908 14/69 (20%)
DnaJ_C 298..416 CDD:199909 30/136 (22%)
Dnaja2NP_062768.1 PTZ00037 4..412 CDD:240236 88/399 (22%)
CXXCXGXG motif 143..150 1/6 (17%)
CXXCXGXG motif 159..166 3/6 (50%)
CXXCXGXG motif 186..193 4/6 (67%)
CXXCXGXG motif 202..209 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.