DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnajc1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001071003.1 Gene:dnajc1 / 553324 ZFINID:ZDB-GENE-061103-529 Length:526 Species:Danio rerio


Alignment Length:152 Identity:40/152 - (26%)
Similarity:58/152 - (38%) Gaps:42/152 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQL-- 163
            :|:.|.||:.|:..:||.|:..|:...|||....|.....|::|...|.:|.||.:|..||.:  
Zfish    43 FYEFLSVNQDASSSEIRKAYRKLSLILHPDKNKDENAENQFRQLVAIYEVLKDEERRQRYDDILV 107

  Fly   164 GGIKD-----------------ERAFL-------------------EQAGNPLNVGLEEAKKFDS 192
            .|:.|                 |..||                   :|....|:....|.||..:
Zfish   108 NGLPDWRQPVFYYRRVRKMSNGELGFLLFLILTVGHYAVIWSIYLEKQLDELLSRKKREKKKKQT 172

  Fly   193 DKTTNDEINKL---KSNEFDLP 211
            .|.| ||:..|   |:...|.|
Zfish   173 SKMT-DEMKPLAQDKNERSDRP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 40/152 (26%)
DnaJ 101..161 CDD:278647 20/59 (34%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
dnajc1NP_001071003.1 DnaJ 42..103 CDD:278647 20/59 (34%)
SANT 307..353 CDD:238096
SANT 469..514 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.