DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnajb2

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_012825839.2 Gene:dnajb2 / 548454 XenbaseID:XB-GENE-951530 Length:361 Species:Xenopus tropicalis


Alignment Length:350 Identity:79/350 - (22%)
Similarity:123/350 - (35%) Gaps:115/350 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDST-----HSEQKLKHFQELSNAYNILTDETKRLEY 160
            ||.:|||.|:|:...|:.|:..||.|:|||..     |:|:|   |::::.||.:|:|..||..|
 Frog     4 YYDILGVPRNASQDDIKRAYRKLALRWHPDKNPDNKEHAERK---FKDIAEAYEVLSDGEKREAY 65

  Fly   161 DQL-GGIKDERAF-LEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKK 223
            |.: .|..|..|| ..:...|.:.|.                      :|..|.|......|   
 Frog    66 DNMTSGFSDPGAFRATRVQRPFDFGF----------------------QFRSPEDVFRDFFG--- 105

  Fly   224 RIELRYLRKCETCKGKSQL--MAHRDV--------------------------GKEPCRRCNGTG 260
                          ||...  |...||                          |.|......|.|
 Frog   106 --------------GKDPFPHMIGDDVFMFPNHPHGVTHHANSVPMFPSSFHFGNEFSFHSGGLG 156

  Fly   261 KVMTKTPTFSSVNTCTQ-CKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPE 324
                .:..|.||:|.|: ..|||.|.:...|....|..|..:.::...:.:|..| |:...:...
 Frog   157 ----GSRNFCSVSTSTKFVNGKRITTKRIMENDVERIEVEEDGELKSILVNGVED-DLALAVELS 216

  Fly   325 TKQQVTY-----RLSVPSSDYFRR--VGNDILTDK-----HLNISEAILGGSFQIRGLYESVELR 377
            .::|.:.     |...||.:..:|  .|..::.|:     .|.::.|.        .|.|..:.|
 Frog   217 KREQASVPRASARTDGPSYNIQQRSPPGTPVVQDRDDEDEELQLAMAC--------SLSEFEQSR 273

  Fly   378 VEPGTQSHTQVVLNGKGVRSREGVG 402
            ..|            :||||::.:|
 Frog   274 QHP------------EGVRSKKQLG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 78/349 (22%)
DnaJ 101..161 CDD:278647 25/64 (39%)
DnaJ_zf 233..296 CDD:199908 19/91 (21%)
DnaJ_C 298..416 CDD:199909 21/116 (18%)
dnajb2XP_012825839.2 PRK10767 3..>106 CDD:236757 37/143 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.