DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7387 and DNAJB12

DIOPT Version :9

Sequence 1:	NP_648186.3	Gene:	CG7387 / 38915	FlyBaseID:	FBgn0035852	Length:	449	Species:	Drosophila melanogaster
Sequence 2:	NP_001352009.1	Gene:	DNAJB12 / 54788	HGNCID:	14891	Length:	377	Species:	Homo sapiens

Alignment Length:	138	Identity:	43/138 - (31%)
Similarity:	71/138 - (51%)	Gaps:	13/138 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    65 PDRQREA-KRTSAGATPQQVSSPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYH 128
            |....|| ..::.|.|.:||:  |||..:   ..|| ||::|||:|.|:.:.::.|:..||.::|
Human    80 PSANGEAGGESTKGYTAEQVA--AVKRVK---QCKD-YYEILGVSRGASDEDLKKAYRRLALKFH 138

  Fly   129 PDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGGIKDERAFLEQAGNPLNVGLEEAKKFDSD 193
            ||..|:....:.|:.:..||.:|::..||.:|||.|..|.:.|.........:.|      |::|
Human   139 PDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRG------FEAD 197

  Fly   194 KTTNDEIN 201
            .:..|..|
Human   198 ISPEDLFN 205

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7387	NP_648186.3	DnaJ_bact	101..431	CDD:274090	31/101 (31%)
		DnaJ	101..161	CDD:278647	20/59 (34%)
		DnaJ_zf	233..296	CDD:199908
		DnaJ_C	298..416	CDD:199909
DNAJB12	NP_001352009.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	45..92		3/11 (27%)
		DnaJ	110..>236	CDD:333066	32/103 (31%)
		DUF1977	268..368	CDD:312722
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910