DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and AgaP_AGAP001859

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_001238449.2 Gene:AgaP_AGAP001859 / 4577058 VectorBaseID:AGAP001859 Length:385 Species:Anopheles gambiae


Alignment Length:147 Identity:43/147 - (29%)
Similarity:63/147 - (42%) Gaps:11/147 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KPAYYPDRQREAKRTSAGATPQQVSSPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAFYALA 124
            :|.:..:.:....:.:...|.:|.:  |||..|.   .|| :|:||||.:.||..:|:..:...|
Mosquito    80 RPVHREEEKPAEPKLNVDYTQEQAN--AVKRVQK---CKD-FYEVLGVTQEATDSEIKKCYKKHA 138

  Fly   125 KRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQL----GGIKDERAFLEQAGNPLNV-GL 184
            .:.|||...:...::.|:.|.||...|||..||..||..    ||....||.....|..... |.
Mosquito   139 LQLHPDKNKAPGAMEAFKSLGNAVETLTDPQKRKAYDLYRTTGGGPAGTRARASNGGYTYGQNGF 203

  Fly   185 EEAKKFDSDKTTNDEIN 201
            .....||:....||..|
Mosquito   204 NFQSDFDTGINPNDLFN 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 34/106 (32%)
DnaJ 101..161 CDD:278647 21/59 (36%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
AgaP_AGAP001859XP_001238449.2 DnaJ 113..>221 CDD:223560 36/109 (33%)
DnaJ 114..175 CDD:278647 22/61 (36%)
DUF1977 280..377 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.