DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and CG6693

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001262473.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster


Alignment Length:332 Identity:70/332 - (21%)
Similarity:128/332 - (38%) Gaps:84/332 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQK---LKHFQELSNAYNILTDETKRLEYDQL 163
            ||::.:.|.|..::::.|::.|:...|||....|||   .:.|:.||..|.:|||..||..||:.
  Fly    17 YKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVLTDTQKRALYDEQ 81

  Fly   164 GGIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPL---DFLEATVGCKKRI 225
            |.|.|:    :::.:.|:..||...|. ....|.::||..:....:..|   |..:|.:|.|..|
  Fly    82 GVIDDD----DESESKLSSWLELWSKI-FKPITEEDINNYEKEYVESELERTDLKKAYLGGKGCI 141

  Fly   226 ELRYLRKCETCKGKSQLMAH---RDVGKEP-----CRRCNGTG-----KVMTKTPT--------- 268
                          :.||.|   ..|..||     .:....:|     |:.|:.|.         
  Fly   142 --------------NYLMNHVPFMKVEDEPRIQKIVQDMIASGEVPEYKIFTEEPAAKRKKRHQK 192

  Fly   269 ----FSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQV 329
                |.......:...:|...::|.:...|.|    ::..|:......|:.:..::::       
  Fly   193 YAREFKEAKVIKERLKRRQKEKDDQDLADNGG----DLQQMILARRNQRESNFGSLMD------- 246

  Fly   330 TYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNG-K 393
              ||       ..:.||:       :.|:.:...:|:     :..:...:|..:..|:..||| |
  Fly   247 --RL-------MEKYGNE-------DDSDTVDFSAFE-----KKKKKSKKPAAKQETKPKLNGVK 290

  Fly   394 GVRSREG 400
            ..|..:|
  Fly   291 AGRVEKG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 70/332 (21%)
DnaJ 101..161 CDD:278647 21/61 (34%)
DnaJ_zf 233..296 CDD:199908 14/88 (16%)
DnaJ_C 298..416 CDD:199909 16/104 (15%)
CG6693NP_001262473.1 DnaJ 15..79 CDD:278647 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.