DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and P58IPK

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster


Alignment Length:180 Identity:49/180 - (27%)
Similarity:75/180 - (41%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GAATDCCRKTSHCLE-----LDRAPAVAACWICMRMISQYQFRTTKPAYYPDRQREAKRTSAGAT 79
            |.|...|::....::     .|||.|:....:....|..:|...       |.:....|...|. 
  Fly   326 GKALQQCKEALDIMKDAQVYCDRADALLGTEMYDDAIHSFQAAL-------DLEESNTRAKEGI- 382

  Fly    80 PQQVSSPAVKYPQSRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKL---KHF 141
                  ...|..|.:...:| |||:|||.|.|:.|:|..|:...|:::|||:...|:|.   |.|
  Fly   383 ------QRAKKLQKQSERRD-YYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKF 440

  Fly   142 QELSNAYNILTDETKRLEYD-----------QLGGIKDERAFLE-QAGNP 179
            .:::.|..:|||..||.::|           |.||...|..|.. |.|:|
  Fly   441 IDIAAAKEVLTDPEKRRQFDNGEDPLDPESNQRGGFHGEHPFGHFQHGSP 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 34/94 (36%)
DnaJ 101..161 CDD:278647 25/62 (40%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
P58IPKNP_649916.1 TPR_11 42..108 CDD:290150
TPR repeat 43..71 CDD:276809
TPR repeat 76..106 CDD:276809
TPR_11 78..142 CDD:290150
TPR repeat 111..139 CDD:276809
TPR_1 113..144 CDD:278916
TPR_19 167..234 CDD:291240
TPR repeat 190..220 CDD:276809
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809 3/10 (30%)
TPR_11 312..373 CDD:290150 10/53 (19%)
TPR repeat 341..371 CDD:276809 6/36 (17%)
TPR repeat 376..399 CDD:276809 6/30 (20%)
DnaJ 395..>485 CDD:223560 32/90 (36%)
DnaJ 396..460 CDD:278647 26/64 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.