Sequence 1: | NP_648186.3 | Gene: | CG7387 / 38915 | FlyBaseID: | FBgn0035852 | Length: | 449 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 52/207 - (25%) |
---|---|---|---|
Similarity: | 83/207 - (40%) | Gaps: | 60/207 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTH-SEQKLKHFQELSNAYNILTDETKRLEYDQ-- 162
Fly 163 ---LGG-------------IKD--ERAFL----------EQAGNPLNVGLEE------AKKFDSD 193
Fly 194 KTTNDEINKLK--------SNEFDLP-LDFLEATVGCKKRIELRYLRKC--ETCKGKSQLMAHRD 247
Fly 248 --------VGKE 251 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7387 | NP_648186.3 | DnaJ_bact | 101..431 | CDD:274090 | 52/207 (25%) |
DnaJ | 101..161 | CDD:278647 | 23/60 (38%) | ||
DnaJ_zf | 233..296 | CDD:199908 | 8/29 (28%) | ||
DnaJ_C | 298..416 | CDD:199909 | |||
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 23/60 (38%) |
DnaJ | 27..89 | CDD:278647 | 23/60 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |