DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and CG11035

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster


Alignment Length:207 Identity:52/207 - (25%)
Similarity:83/207 - (40%) Gaps:60/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTH-SEQKLKHFQELSNAYNILTDETKRLEYDQ-- 162
            :|..||:.|..|..:|::|:|.|:..||||... ||...|.|:|::.||.||.:...|..||:  
  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGI 92

  Fly   163 ---LGG-------------IKD--ERAFL----------EQAGNPLNVGLEE------AKKFDSD 193
               .|.             ::|  |..|.          :.||.......:|      .|.||..
  Fly    93 VHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDRR 157

  Fly   194 KTTNDEINKLK--------SNEFDLP-LDFLEATVGCKKRIELRYLRKC--ETCKGKSQLMAHRD 247
            :....:.:::|        |.:.|:. |.|:.|.|.    :.|.:|.:.  :|.|.|::....||
  Fly   158 QAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVA----VYLMFLAESSYDTPKQKAKERYRRD 218

  Fly   248 --------VGKE 251
                    |||:
  Fly   219 QEEREQKLVGKQ 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 52/207 (25%)
DnaJ 101..161 CDD:278647 23/60 (38%)
DnaJ_zf 233..296 CDD:199908 8/29 (28%)
DnaJ_C 298..416 CDD:199909
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/60 (38%)
DnaJ 27..89 CDD:278647 23/60 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.