DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnajc5gb

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_005158621.1 Gene:dnajc5gb / 393371 ZFINID:ZDB-GENE-040426-1238 Length:212 Species:Danio rerio


Alignment Length:237 Identity:56/237 - (23%)
Similarity:92/237 - (38%) Gaps:55/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPD-STHSEQKLKHFQELSNAYNILTDETKRLEYDQLGG 165
            |:.||:.:.|:.:.|:.|:..||.::||| :.::.:..:.|:|::||.:||.|||||..||:.| 
Zfish    19 YQTLGLQKGASSEDIKKAYRKLALKHHPDKNPNNPEAAEKFKEINNANSILNDETKRQIYDEYG- 82

  Fly   166 IKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATVGCKKRIELRYL 230
                           ::||..|.:|..|               .:...||.:....|..:.:..:
Zfish    83 ---------------SMGLYIADQFGED---------------SVKYYFLMSKCWFKTLLCIGTI 117

  Fly   231 RKCETCKGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETC--- 292
            ..|..|               .|..|...||.....|..:......:...:......|.||.   
Zfish   118 LTCCCC---------------CCCCCFCCGKCGGSEPPDNFQYVDPEELAEEEERSRDNETVIIG 167

  Fly   293 ----SNRGFVVSNVDVMVSVPSG-SRDGDVVNIINPETKQQV 329
                |......|...|:|.:|.. |.|||..::|.|:|..:|
Zfish   168 QPIPSPAPAADSGYPVIVGMPIPLSADGDTASLIPPDTHVEV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 56/237 (24%)
DnaJ 101..161 CDD:278647 22/59 (37%)
DnaJ_zf 233..296 CDD:199908 11/69 (16%)
DnaJ_C 298..416 CDD:199909 12/33 (36%)
dnajc5gbXP_005158621.1 DnaJ 14..>86 CDD:223560 25/82 (30%)
DnaJ 17..79 CDD:278647 22/59 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.