DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and DnaJ-60

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_523840.1 Gene:DnaJ-60 / 37869 FlyBaseID:FBgn0260775 Length:217 Species:Drosophila melanogaster


Alignment Length:96 Identity:26/96 - (27%)
Similarity:47/96 - (48%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SRGMPK--DYYYKVLGVNRHATIQQIRSAFYALAKRYHPD---STHSEQKLKHFQELSNAYNILT 152
            |...|:  :.:|:||.:....:.:::|:||..|:|.||||   :....::...|.::|.||..|.
  Fly    17 SNDKPRKPETHYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSNAACPERTARFVQISEAYKTLI 81

  Fly   153 DETKRLEYDQLGGIKDERAFLEQAGNPLNVG 183
            ...:|.:||.....:..|:.....|..:|.|
  Fly    82 KPERRRDYDDSLLWQPSRSDRSPVGETVNPG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 24/86 (28%)
DnaJ 101..161 CDD:278647 18/62 (29%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
DnaJ-60NP_523840.1 DnaJ 26..90 CDD:278647 18/63 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.