DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and DNAJB13

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_011543306.1 Gene:DNAJB13 / 374407 HGNCID:30718 Length:350 Species:Homo sapiens


Alignment Length:305 Identity:67/305 - (21%)
Similarity:113/305 - (37%) Gaps:104/305 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GVN---RHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQL---- 163
            |||   .|:|.:.....:..||.::||..::.....:.|::::.||::|:|..||..||:.    
Human    41 GVNIHLEHSTAEDKDQRYRRLALKHHPLKSNEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEG 105

  Fly   164 --GGI------------------KDERAFLEQAG--NPLNVGLEEAKKFDSDKTTND-EINKLKS 205
              |||                  |.|:.|.|..|  ||.      ::.||::.:..| ....|:.
Human   106 LKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPF------SEFFDAEGSEVDLNFGGLQG 164

  Fly   206 N---------EFDLPLDFLEATVGCKKRIEL--RYLRK---CETCKGKSQLMAHRDVGKEPCRRC 256
            .         |.||.|...:...||.|:|::  |.|.:   ..|.|.|...:   ||  :|..| 
Human   165 RGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTI---DV--KPGWR- 223

  Fly   257 NGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSV-----PSGSRDGD 316
                                  :|.|.|...:    .::|..:...|::..|     |...|:.|
Human   224 ----------------------QGTRITFEKE----GDQGPNIIPADIIFIVKEKLHPRFRREND 262

  Fly   317 VVNIINP------------ETKQQVTYRLSVPSSD-----YFRRV 344
            .:..:||            |.:......|::|.:|     ||::|
Human   263 NLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 67/305 (22%)
DnaJ 101..161 CDD:278647 16/57 (28%)
DnaJ_zf 233..296 CDD:199908 10/62 (16%)
DnaJ_C 298..416 CDD:199909 14/69 (20%)
DNAJB13XP_011543306.1 DnaJ_bact 48..346 CDD:274090 64/298 (21%)
DnaJ 48..99 CDD:278647 13/50 (26%)
DnaJ_C 174..336 CDD:199909 35/166 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.