DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajc16

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001014216.1 Gene:Dnajc16 / 362652 RGDID:1359395 Length:771 Species:Rattus norvegicus


Alignment Length:74 Identity:27/74 - (36%)
Similarity:42/74 - (56%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLGGI 166
            |:||||:|.|:...|:.|:..||:.:|||..........|.::|.||.||::|.||..||..|..
  Rat    31 YRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDKFIQISKAYEILSNEEKRTNYDHYGDA 95

  Fly   167 KDERAFLEQ 175
            .:.:.:.:|
  Rat    96 GENQGYQQQ 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 27/74 (36%)
DnaJ 101..161 CDD:278647 23/58 (40%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
Dnajc16NP_001014216.1 DnaJ 29..90 CDD:278647 23/58 (40%)
TRX_DnaJ 133..242 CDD:239261
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.