DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnajc24

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001178782.1 Gene:Dnajc24 / 362184 RGDID:1564710 Length:148 Species:Rattus norvegicus


Alignment Length:154 Identity:34/154 - (22%)
Similarity:61/154 - (39%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHS-------EQKLKHFQELSNAYNILTDET 155
            |..:|.:||.:..|.:..::..:..|...||||...:       |:.::.|.|:..|:.||.:|.
  Rat     8 KKDWYSILGADPSADVSDLKQKYQKLILLYHPDKQSADVPAGTMEECVQKFIEIDQAWKILGNEE 72

  Fly   156 KRLEYDQLGGIKDERAFLEQAGNPL-NVGLEEAKKFDSDKTTNDEINKLKSNEFDLPLDFLEATV 219
            .:.:||           |::..:.| |||..:|:....:.:.|.:     ...|.|       :.
  Rat    73 TKKKYD-----------LQRHEDELRNVGPVDAQVHLEEMSWNKD-----EESFSL-------SC 114

  Fly   220 GC-------KKRIELRYLRKCETC 236
            .|       |...:...|..|:||
  Rat   115 RCGGKYTVYKDEAQEANLISCDTC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 33/151 (22%)
DnaJ 101..161 CDD:278647 16/66 (24%)
DnaJ_zf 233..296 CDD:199908 3/4 (75%)
DnaJ_C 298..416 CDD:199909
Dnajc24NP_001178782.1 DnaJ 10..78 CDD:395170 16/67 (24%)
zf-CSL 94..147 CDD:398744 10/57 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.