DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and Dnaja3

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001033684.2 Gene:Dnaja3 / 360481 RGDID:1306527 Length:480 Species:Rattus norvegicus


Alignment Length:362 Identity:120/362 - (33%)
Similarity:185/362 - (51%) Gaps:33/362 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 SRGMPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKH-FQELSNAYNILTDETK 156
            |..:.||.||::|||.|:|:.:.|:.|:|.|||:||||:...:.|.|. |.:|:.||.:|:||.|
  Rat    86 SASLAKDDYYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVK 150

  Fly   157 RLEYDQLG--GIKDERAFLEQA---GNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDLP----- 211
            |.:||..|  |.....:...|.   |.| :|..||..:....:.::......: |.||.|     
  Rat   151 RKQYDAYGSAGFDPGASSSGQGYWRGGP-SVDPEELFRKIFGEFSSSPFGDFQ-NVFDQPQEYIM 213

  Fly   212 -LDFLEATVGCKKRIELRYLRKCETCKGKSQLMAHRDVGKEP------CRRCNGTGKVMTKTPTF 269
             |.|.:|..|..|...:..:..||.|.||         |.||      |..|:|:|.....|..|
  Rat   214 ELTFNQAAKGVNKEFTVNIMDTCERCDGK---------GNEPGTKVQHCHYCSGSGMETINTGPF 269

  Fly   270 SSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGSRDGDVVNIINPETKQQVTYRLS 334
            ...:||.:|.|:.....|.|..|...|.......|.|.||:|..||..|.:  |..|:::.....
  Rat   270 VMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTVPVPAGVEDGQTVRM--PVGKREIFVTFR 332

  Fly   335 VPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVELRVEPGTQSHTQVVLNGKGVR--S 397
            |..|..|||.|.||.:|..::|::|||||:.:.:||||::.:.:..|.|:..::.|.|||:.  :
  Rat   333 VQKSPVFRRDGADIHSDLFISIAQAILGGTAKAQGLYETINVTIPAGIQTDQKIRLTGKGIPRIN 397

  Fly   398 REGVGNHIVTLKVRIPRNLSVKQRQLVLALSQAEDPV 434
            ..|.|:|.:.:|:|:|:.||.:|:.|:|:.::.|..|
  Rat   398 SYGYGDHYIHIKIRVPKRLSSRQQNLILSYAEDETDV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 115/349 (33%)
DnaJ 101..161 CDD:278647 28/60 (47%)
DnaJ_zf 233..296 CDD:199908 21/68 (31%)
DnaJ_C 298..416 CDD:199909 41/119 (34%)
Dnaja3NP_001033684.2 DnaJ 90..480 CDD:223560 119/358 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53632
OrthoDB 1 1.010 - - D436402at33208
OrthoFinder 1 1.000 - - FOG0001676
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR44145
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.