powered by:
Protein Alignment CG7387 and K07F5.16
DIOPT Version :9
Sequence 1: | NP_648186.3 |
Gene: | CG7387 / 38915 |
FlyBaseID: | FBgn0035852 |
Length: | 449 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023271.1 |
Gene: | K07F5.16 / 3565979 |
WormBaseID: | WBGene00010640 |
Length: | 155 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 25/68 - (36%) |
Similarity: | 40/68 - (58%) |
Gaps: | 3/68 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 PKD-YYYKVLGVNRHATIQQIRSAFYALAKRYHPDST--HSEQKLKHFQELSNAYNILTDETKRL 158
||: ..|::||.:..::|.||.:.:.|..:..|||.. |:....:.|.||.|||:|||.:::|.
Worm 11 PKEPKLYRLLGCDESSSIDQITAEYRARVRDCHPDKVKEHNTNSTEKFMELQNAYSILTSDSRRK 75
Fly 159 EYD 161
.||
Worm 76 TYD 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.