DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and K07F5.16

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001023271.1 Gene:K07F5.16 / 3565979 WormBaseID:WBGene00010640 Length:155 Species:Caenorhabditis elegans


Alignment Length:68 Identity:25/68 - (36%)
Similarity:40/68 - (58%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PKD-YYYKVLGVNRHATIQQIRSAFYALAKRYHPDST--HSEQKLKHFQELSNAYNILTDETKRL 158
            ||: ..|::||.:..::|.||.:.:.|..:..|||..  |:....:.|.||.|||:|||.:::|.
 Worm    11 PKEPKLYRLLGCDESSSIDQITAEYRARVRDCHPDKVKEHNTNSTEKFMELQNAYSILTSDSRRK 75

  Fly   159 EYD 161
            .||
 Worm    76 TYD 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 23/63 (37%)
DnaJ 101..161 CDD:278647 21/61 (34%)
DnaJ_zf 233..296 CDD:199908
DnaJ_C 298..416 CDD:199909
K07F5.16NP_001023271.1 DnaJ 16..78 CDD:365959 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.