DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and dnj-13

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001366737.1 Gene:dnj-13 / 3564910 WormBaseID:WBGene00001031 Length:331 Species:Caenorhabditis elegans


Alignment Length:380 Identity:90/380 - (23%)
Similarity:147/380 - (38%) Gaps:102/380 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 MPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEY 160
            |.|| ||||||:::.||..:|:.|:..:|.:||||..........|:|::.||::|:|:.|:..|
 Worm     1 MGKD-YYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKKKKIY 64

  Fly   161 DQLG--GIKD----------ERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSNEFDL--- 210
            ||.|  |:|:          .....|..|:|:|:       |.|....:|.........|||   
 Worm    65 DQFGEEGLKEGGPGAGGGGGGGMHYEFRGDPMNI-------FSSFFGGSDPFGAGGPGMFDLGGG 122

  Fly   211 ---PLDFLEATVGCK-----------KRIELRYLRKCETCKGKSQLMAH------RDVGKEPCRR 255
               |..|.....|..           :|...|          :...:.|      .||.|...::
 Worm   123 AGGPNMFFMNQGGMDDGMFGGMHQGGRRGHAR----------QDPAVLHDLSVSLEDVLKGTTKK 177

  Fly   256 CNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNRGFVVSNVDVMVSVPSGS-----RDG 315
            ...|.||||.             ..:|..::            |..|.:.....||:     ::|
 Worm   178 MKITRKVMTD-------------NAQRLEDK------------VLTVTIKPGWKSGTKITFPKEG 217

  Fly   316 DVVNIINP-ETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGLYESVELR-- 377
            |.    :| .|...:.:.:.......|:|.|:||...:.:::..|:.|....|..| :..:.|  
 Worm   218 DQ----HPNRTPADIVFVIKDKPHPKFKREGSDIKRVEKISLKSALTGLDIMIPTL-DGADYRLQ 277

  Fly   378 ----VEPGTQSHTQVVLNGKGV---RSREGVGNHIVTLKVRIPRNLSVKQRQLVL 425
                ::|||...    |.|||:   :|....|:.|:...|..|..|:..||:::|
 Worm   278 LNDVIKPGTTRR----LTGKGLPNPKSPSHRGDLIIEFDVEFPSQLNPTQREVIL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 87/375 (23%)
DnaJ 101..161 CDD:278647 22/59 (37%)
DnaJ_zf 233..296 CDD:199908 10/68 (15%)
DnaJ_C 298..416 CDD:199909 30/132 (23%)
dnj-13NP_001366737.1 DnaJ 1..331 CDD:223560 90/380 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.