DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and DnaJ-H

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001260431.1 Gene:DnaJ-H / 34707 FlyBaseID:FBgn0032474 Length:440 Species:Drosophila melanogaster


Alignment Length:409 Identity:108/409 - (26%)
Similarity:169/409 - (41%) Gaps:96/409 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQLG-- 164
            |.||.|...||.::|:..:..|||.:|||.  :......|:|:|.||.:|:|..||..||:.|  
  Fly     7 YDVLKVAPDATDEEIKKNYRKLAKEFHPDK--NPDAGDKFKEISFAYEVLSDPEKRRIYDRYGLK 69

  Fly   165 -------GIKDERAFLEQAGNPLNVGLEEAKKFDSDKTTNDEINKLKSN---EFDLPLDFLEATV 219
                   |..|...|.             |:.|..|:.:::...:....   :.:|.|:  |..|
  Fly    70 GLQEGAEGFSDASEFF-------------AQWFPFDRVSSEGRGRRNGKVVVKVELTLE--EIYV 119

  Fly   220 -GCKKRIELRYLRKCETCKGK-SQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVN----TCTQC 278
             |.||::|....:.|..|.|. ....||     |.|..|.|.|:....  ||..::    ||..|
  Fly   120 GGMKKKVEYNRQKLCSKCNGDGGPKEAH-----ESCETCGGAGRAAAF--TFMGLSPFDTTCPTC 177

  Fly   279 KGKRFTNRND--CETCSNRGFVVSNV--DV--------MVSVP--------SGSRDGDVVNIINP 323
            .|:.||.|:|  |..|...|||...:  |:        |:.||        .|...||::.:|: 
  Fly   178 DGRGFTIRDDKKCSPCQGSGFVEQKMKRDLVVERGAPHMLKVPFANEGHQMRGGEFGDLIVVIS- 241

  Fly   324 ETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSFQIRGL-YESVELRVEPG-TQSHT 386
                |:.:.:      :.||..|..:.|..:||:||:.|.|...:.| ..:|.||..|| ...|.
  Fly   242 ----QMEHPI------FQRRHANLYMRDLEINITEALCGYSHCFKHLDGRNVCLRTYPGEVLQHN 296

  Fly   387 QV-VLNGKGV---RSREGVGNHIVTLKVRIPRN-------LSVKQ-----RQLVLALSQAEDPVF 435
            |: ::.|.|:   ......|:..:..||:.|.|       |::.:     ||.::....||:...
  Fly   297 QIKMVRGSGMPVFNKATDSGDLYMKFKVKFPDNDFATAPQLAMLEDLLPPRQPIVIPKNAEEVQM 361

  Fly   436 -----EPKTKSTEAGNLSH 449
                 :|:.:..|.|..||
  Fly   362 TDYKPQPRQQEDEDGQSSH 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 101/384 (26%)
DnaJ 101..161 CDD:278647 22/58 (38%)
DnaJ_zf 233..296 CDD:199908 22/69 (32%)
DnaJ_C 298..416 CDD:199909 35/148 (24%)
DnaJ-HNP_001260431.1 DnaJ 1..363 CDD:223560 103/390 (26%)
DnaJ 5..64 CDD:278647 22/58 (38%)
DnaJ_C 106..329 CDD:199909 66/242 (27%)
DnaJ_zf 134..197 CDD:199908 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.