DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and DNAJB1

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_006136.1 Gene:DNAJB1 / 3337 HGNCID:5270 Length:340 Species:Homo sapiens


Alignment Length:395 Identity:79/395 - (20%)
Similarity:147/395 - (37%) Gaps:127/395 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 MPKDYYYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEY 160
            |.|| ||:.||:.|.|:.::|:.|:...|.|||||........:.|:|::.||::|:|..||..:
Human     1 MGKD-YYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIF 64

  Fly   161 DQLG--GIK-----------------------DERA-FLEQAG--NPLNVGL-----EEAKKFDS 192
            |:.|  |:|                       |..| |.|..|  ||.:...     ||....|.
Human    65 DRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDD 129

  Fly   193 DKT---------TNDEINKLKSNE------------FDLPLDFLEATVGCKKRIELRYLRKCETC 236
            ..:         ||....:.:|.:            .||.:...|...||.|::::.:       
Human   130 PFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISH------- 187

  Fly   237 KGKSQLMAHRDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCK-GKRFTNRNDCETCSNRGFVVS 300
                             :|.|..||.:.......::......| |.:.|...:.:..||      
Human   188 -----------------KRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSN------ 229

  Fly   301 NVDVMVSVPSGSRDGDVVNIINPETKQQVTYRLSVPSSDYFRRVGNDILTDKHLNISEAILGGSF 365
                  ::|:     |:|.::..:            ..:.|:|.|:|::....:::.||:.|.:.
Human   230 ------NIPA-----DIVFVLKDK------------PHNIFKRDGSDVIYPARISLREALCGCTV 271

  Fly   366 QIRGL--------YESVELRVEPGTQSHTQVVLNGKGV---RSREGVGNHIVTLKVRIPRNLSVK 419
            .:..|        ::.|   :.||.:..    :.|:|:   ::.|..|:.|:..:|..|..:...
Human   272 NVPTLDGRTIPVVFKDV---IRPGMRRK----VPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQT 329

  Fly   420 QRQLV 424
            .|.::
Human   330 SRTVL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 76/390 (19%)
DnaJ 101..161 CDD:278647 22/59 (37%)
DnaJ_zf 233..296 CDD:199908 9/63 (14%)
DnaJ_C 298..416 CDD:199909 21/128 (16%)
DNAJB1NP_006136.1 DnaJ 1..340 CDD:223560 79/395 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.