DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7387 and CG7556

DIOPT Version :9

Sequence 1:NP_648186.3 Gene:CG7387 / 38915 FlyBaseID:FBgn0035852 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster


Alignment Length:341 Identity:65/341 - (19%)
Similarity:134/341 - (39%) Gaps:84/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 YYKVLGVNRHATIQQIRSAFYALAKRYHPDSTHSEQKLKHFQELSNAYNILTDETKRLEYDQL-- 163
            :|:.:|:|:.||..:::.||..|:...|||...:|.....|:.|.:.|.:|.|.::|.:||::  
  Fly    41 FYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLK 105

  Fly   164 GGIKDERAFLEQAGNPLNVGLEEA----------------------KKFDSDKTTNDEINKLKSN 206
            .|:.:.::.|........:||.|.                      ||:.:::....::.||:..
  Fly   106 EGMPNWKSALYYYRRMRKIGLYEGAFILFLITTVGQYLFAWAAYLEKKYTAEQVFGTKLKKLQKK 170

  Fly   207 EFDLPLDFLEATVGC--------------------------------------KKRIELRYLRKC 233
            ..::.:|.:.:.:..                                      |:|.||..:|:.
  Fly   171 NKNIDMDVILSEIPMPSLLNTLPIQIPLALWNLPRTIKNGFSKANELKELALEKRRQELEAVRRQ 235

  Fly   234 ETCKGKSQLMAH-RDVGKEPCRRCNGTGKVMTKTPTFSSVNTCTQCKGKRFTNRNDCETCSNR-- 295
            |..:.:::..|. |...||..|:.....|...||.  ..:...:|.:.:..|:.:.....|.:  
  Fly   236 EELEREAEEQARLRKEHKENLRKRKQNSKAPEKTE--EELRGYSQIQTRELTDDDAVRPASQKST 298

  Fly   296 ---GF-----VVSNVDVMVSVP--SGSRDGDVVNIINPETKQQVTYRLSVPSSDYFRRVGNDILT 350
               ||     :...:.::...|  :|||...:...:| .:.|:||:..:....:.:|..|.   |
  Fly   299 VSGGFWTDEDLTELIRLVKKYPGGAGSRWNTIAESMN-RSVQEVTFMAAKMKENGYRIPGQ---T 359

  Fly   351 DKHLNISEAILGGSFQ 366
            |   :::||::..|.|
  Fly   360 D---SVAEALVQESQQ 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7387NP_648186.3 DnaJ_bact 101..431 CDD:274090 65/341 (19%)
DnaJ 101..161 CDD:278647 18/59 (31%)
DnaJ_zf 233..296 CDD:199908 12/68 (18%)
DnaJ_C 298..416 CDD:199909 16/71 (23%)
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 18/59 (31%)
SANT 301..>341 CDD:197842 8/40 (20%)
SANT 304..341 CDD:238096 6/37 (16%)
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.